Tested Applications
| Positive WB detected in | HEK-293 cells, HepG2 cells, HeLa cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells, MCF-7 cells, Jurkat cells, K-562 cells, PC-12 cells |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:20000-1:100000 |
| Immunohistochemistry (IHC) | IHC : 1:150-1:600 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66904-1-Ig targets Glucocorticoid receptor in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28431 Product name: Recombinant human Glucocorticoid receptor protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-350 aa of BC015610 Sequence: MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGNVKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPI Predict reactive species |
| Full Name | nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor) |
| Calculated Molecular Weight | 86 kDa |
| Observed Molecular Weight | 97 kDa |
| GenBank Accession Number | BC015610 |
| Gene Symbol | Glucocorticoid receptor |
| Gene ID (NCBI) | 2908 |
| RRID | AB_2857354 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P04150 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Glucocorticoid receptor (GR, or GCR) also known as NR3C1 (nuclear receptor subfamily 3, group C, member 1) is a receptor for glucocorticoids, which owns a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE) and as a modulator of other transcription factors. It is involved in cell proliferation and differentiation and specifically implicated in newborn birth weight, thus providing a biological mechanism by which NR3C1 expression may influence birth weight (PMID:22810058).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Glucocorticoid receptor antibody 66904-1-Ig | Download protocol |
| IHC protocol for Glucocorticoid receptor antibody 66904-1-Ig | Download protocol |
| WB protocol for Glucocorticoid receptor antibody 66904-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Glucocorticoid receptor Monoclonal antibody (Cat# 66904-1-Ig) has 11 total citations. These appear in journals including Cell, Cell Death & Disease, Antioxidants, Clinical & Experimental Hypertension, Ecotoxicology and Environmental Safety, International Journal of Molecular Sciences, American Journal of Physiology, Journal of Neuroendocrinology, Heliyon, and bioRxiv. Research fields span protein degradation, cancer immunology, kidney injury, neuroinflammation, heart failure, bone loss, muscle atrophy, and neuroendocrinology, with applications mainly in WB, IHC, and IF across human, mouse, and rat models.
| Species | Application | Title |
|---|---|---|
Cell Death Dis Targeting EGFR-binding protein SLC7A11 enhancing antitumor immunity of T cells via inducing MHC-I antigen presentation in nasopharyngeal carcinoma | ||
Antioxidants (Basel) Dim Blue Light at Night Induces Spatial Memory Impairment in Mice by Hippocampal Neuroinflammation and Oxidative Stress | ||
Antioxidants (Basel) Continuous Monochromatic Blue Light Exacerbates High-Fat Diet-Induced Kidney Injury via Corticosterone-Mediated Oxidative Stress | ||
Clin Exp Hypertens Glycyrrhetinic acid ameliorates chronic heart failure via the Nrf2 pathway. | ||
Ecotoxicol Environ Saf Dim blue light at night worsens high-fat diet-induced kidney damage via increasing corticosterone levels and modulating the expression of circadian clock genes |
Reviews
What customers say
The single review for this product is positive, with the user rating it 5 stars. The antibody was used for Western Blot on AC16 cells, and the reviewer described the performance simply as "Good." Overall, the feedback indicates satisfactory results for the tested application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Shubham (Verified Customer) (04-15-2019) | Good
 |
