CoraLite® Plus 488-conjugated Glucocorticoid receptor Monoclonal antibody

Glucocorticoid receptor Monoclonal Antibody for IF-P, FC (Intra)
Cat No. CL488-66904
Clone No.1D9A9

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

IF-P, FC (Intra)

GCCR, GCR, Glucocorticoid receptor, GR, GRL, NR3C1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue
Positive FC (Intra) detected inHeLa cells
Positive FC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66904 targets Glucocorticoid receptor in IF-P, FC (Intra) applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28431

Product name: Recombinant human Glucocorticoid receptor protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-350 aa of BC015610

Sequence: MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGNVKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPI

Predict reactive species
Full Name nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)
Calculated Molecular Weight 86 kDa
Observed Molecular Weight 97 kDa
GenBank Accession NumberBC015610
Gene Symbol Glucocorticoid receptor
Gene ID (NCBI) 2908
RRIDAB_3084285
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP04150
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

NR3C1 is a receptor for glucocorticoids, which owns a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE) and as a modulator of other transcription factors. It is involved in cell proliferation and differentiation and specifically implicated in newborn birth weight, thus providing a biological mechanism by which NR3C1 expression may influence birth weight [PMID:22810058].

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 Glucocorticoid receptor antibody CL488-66904Download protocol
IF protocol for CL Plus 488 Glucocorticoid receptor antibody CL488-66904Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...