Glucocorticoid receptor Monoclonal antibody, PBS Only

• 

  WB analysis using 66904-1-Ig (same clone as 66904-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66904-1-Ig (Glucocorticoid receptor antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 66904-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66904-1-Ig (same clone as 66904-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66904-1-Ig (Glucocorticoid receptor antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66904-1-PBS in a different storage buffer formulation.

• 

  WB analysis of 4T1 using 66904-1-Ig (same clone as 66904-1-PBS)

  4T1 cells were subjected to SDS PAGE followed by western blot with 66904-1-Ig (Glucocorticoid receptor antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66904-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 66904-1-Ig (same clone as 66904-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 66904-1-Ig (Glucocorticoid receptor antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66904-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 66904-1-Ig (same clone as 66904-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66904-1-Ig (Glucocorticoid receptor antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66904-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66904-1-Ig (same clone as 66904-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66904-1-Ig (Glucocorticoid receptor antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66904-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66904-1-Ig (same clone as 66904-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66904-1-Ig (Glucocorticoid receptor antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66904-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 66904-1-Ig (same clone as 66904-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 66904-1-Ig (Glucocorticoid receptor antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66904-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 66904-1-Ig (same clone as 66904-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66904-1-Ig (Glucocorticoid receptor antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66904-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 66904-1-Ig (same clone as 66904-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66904-1-Ig (Glucocorticoid receptor antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66904-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 66904-1-Ig (same clone as 66904-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using Glucocorticoid receptor antibody (66904-1-Ig, Clone: 1D9A9 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66904-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 66904-1-PBS

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using Glucocorticoid receptor antibody (66904-1-PBS, Clone: 1D9A9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Glucocorticoid receptor Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 66904-1-PBS

Clone No.1D9A9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

NR3C1, 1D9A9, GCCR, GCR, GR

---

Tested Applications

• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Product Information

66904-1-PBS targets Glucocorticoid receptor in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28431

  Product name: Recombinant human Glucocorticoid receptor protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC015610

  Sequence: MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGNVKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPI

• Full Name: nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)
• Calculated Molecular Weight: 86 kDa
• Observed Molecular Weight: 97 kDa
• GenBank Accession Number: BC015610
• Gene Symbol: Glucocorticoid receptor
• Gene ID (NCBI): 2908
• RRID: AB_2857354
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P04150
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Glucocorticoid receptor (GR, or GCR) also known as NR3C1 (nuclear receptor subfamily 3, group C, member 1) is a receptor for glucocorticoids, which owns a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE) and as a modulator of other transcription factors. It is involved in cell proliferation and differentiation and specifically implicated in newborn birth weight, thus providing a biological mechanism by which NR3C1 expression may influence birth weight (PMID:22810058).