PI3 Kinase p110 Beta Monoclonal antibody

PI3 Kinase p110 Beta Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 67121-1-Ig
Clone No.1B2A1

Host / Isotype

Mouse / IgG1

Reactivity

human, rat and More (2)

Applications

WB, IHC, IF/ICC, ELISA

PI3K p110(beta), PIK3CB, PI3K, PI3 kinase subunit beta, p110 BETA

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, MCF-7 cells, SH-SY5Y cells, PC-12 cells
Positive IHC detected inhuman lung cancer tissue, human colon cancer tissue, human cervical cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:150-1:600
Immunofluorescence (IF)/ICCIF/ICC : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67121-1-Ig targets PI3 Kinase p110 Beta in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Cited Reactivityhuman, mouse, rat, chicken
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17505

Product name: Recombinant human PIK3CB protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 139-373 aa of BC114432

Sequence: SLKDPEVNEFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRALPHFILVECCKIKKMYEQEMIAIEAAINRNSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHGTELLCKTIVSSEV

Predict reactive species
Full Name phosphoinositide-3-kinase, catalytic, beta polypeptide
Calculated Molecular Weight 1070 aa, 123 kDa
Observed Molecular Weight 120-130 kDa
GenBank Accession NumberBC114432
Gene Symbol PI3 Kinase p110 Beta
Gene ID (NCBI) 5291
RRIDAB_2882424
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP42338
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PIK3CB(phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform) is also named as PIK3C1, PI3K-beta, p110beta. The gene encodes a 1070 amino acid protein which belongs to the PI3/PI4-kinase family. Phosphoinositide 3-kinases (PI3Ks) have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. The class I PI3 kinases are heterodimers composed of 110 kDa catalytic subunits that associate with regulatory adaptor proteins. Four class I catalytic subunits have been identified, PIK3CA (p110α), PIK3CB (p110β), PIK3CD (p110δ) and PIK3CG (p110γ)(PMID:19177002).

Protocols

Product Specific Protocols
IF protocol for PI3 Kinase p110 Beta antibody 67121-1-IgDownload protocol
IHC protocol for PI3 Kinase p110 Beta antibody 67121-1-IgDownload protocol
WB protocol for PI3 Kinase p110 Beta antibody 67121-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Nat Metab

Maternal exercise prevents metabolic disorders in offspring mice through SERPINA3C

Authors - Yang Li
humanWB

J Med Chem

Discovery of Novel Phosphoinositide-3-Kinase α Inhibitors with High Selectivity, Excellent Bioavailability, and Long-Acting Efficacy for Gastric Cancer.

Authors - Yi Hou
humanWB

J Ethnopharmacol

Antitumor mechanism of kangliu pill on gliomas in mice through PI3K-Akt signaling pathway

Authors - Fei Chen
humanWB,IHC

Front Oncol

Relationship Between PTEN and Angiogenesis of Esophageal Squamous Cell Carcinoma and the Underlying Mechanism.

Authors - Chenbo Yang
humanWB

Bioorg Chem

Design, synthesis and biological evaluation of anilide (dicarboxylic acid) shikonin esters as antitumor agents through targeting PI3K/Akt/mTOR signaling pathway.

Authors - Yingying Ma
mouseWB

Chin Med

Integrated metabolomics, network pharmacology and biological verification to reveal the mechanisms of Nauclea officinalis treatment of LPS-induced acute lung injury

Authors - Han Xu
Loading...
||
New chat Able
正在加载,请稍候...