CDC27; APC3 Monoclonal antibody, PBS Only (Capture)

CDC27; APC3 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 67239-1-PBS
Clone No.2F10G2

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), Cytometric bead array, Indirect ELISA

CDC27, ANAPC3, Anaphase-promoting complex subunit 3, APC 3, APC3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67239-1-PBS targets CDC27; APC3 as part of a matched antibody pair:

MP51673-1: 67239-1-PBS capture and 67239-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25588

Product name: Recombinant human CDC27; APC3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 481-830 aa of BC011656

Sequence: ALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF

Predict reactive species
Full Name cell division cycle 27 homolog (S. cerevisiae)
Calculated Molecular Weight 92 kDa
Observed Molecular Weight 90-100 kDa
GenBank Accession NumberBC011656
Gene Symbol CDC27
Gene ID (NCBI) 996
RRIDAB_2882518
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP30260
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CDC27/APC3 is a component of the anaphase-promoting complex (APC/cyclosome), which is composed of eight subunits and highly conserved in eukaryotic cells. The APC/cyclosome complex acts as a cell cycle-regulated E3 ubiquitin ligase which mediates ubiquitination and subsequent degradation of target proteins, and lead to the progression control through mitosis and the G1 phase of the cell cycle.

Loading...
||
New chat

Able

正在加载,请稍候...