CD300a Monoclonal antibody

CD300a Monoclonal Antibody for WB, ELISA

Cat No. 67242-1-Ig

Clone No. 2F9C5

Review Product

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, ELISA

Synonyms

2F9C5, CD300 antigen-like family member A, CD300a molecule, CLM 8, CLM-8

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWB

WB analysis of THP-1 using 67242-1-Ig
THP-1 cells were subjected to SDS PAGE followed by western blot with 67242-1-Ig (CD300A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of K-562 using 67242-1-Ig
K-562 cells were subjected to SDS PAGE followed by western blot with 67242-1-Ig (CD300A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HL-60 using 67242-1-Ig
HL-60 cells were subjected to SDS PAGE followed by western blot with 67242-1-Ig (CD300A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human spleen using 67242-1-Ig
human spleen tissue were subjected to SDS PAGE followed by western blot with 67242-1-Ig (CD300A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of Raji using 67242-1-Ig
Raji cells were subjected to SDS PAGE followed by western blot with 67242-1-Ig (CD300A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of Jurkat using 67242-1-Ig
Jurkat cells were subjected to SDS PAGE followed by western blot with 67242-1-Ig (CD300A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD300a in ?

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in

THP-1 cells, HL-60 cells, human spleen tissue, Jurkat cells, K-562 cells, Raji cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67242-1-Ig targets CD300a in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag5776 Product name: Recombinant human CD300A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 21-141 aa of BC032352 Sequence: CRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPVVEVEVSVFPASTSMTPASITAAKT Predict reactive species
Full Name	CD300a molecule
Calculated Molecular Weight	299 aa, 33 kDa
Observed Molecular Weight	50-60 kDa
GenBank Accession Number	BC032352
Gene Symbol	CD300a
Gene ID (NCBI)	11314
RRID	AB_2882521
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	Q9UGN4
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.