Use Able AI chat for product recommendations

GNMT Monoclonal antibody

GNMT Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67294-1-Ig
Clone No. 1B5E3
Publications (2)
Reviews (1)
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

EC:2.1.1.20, glycine N methyltransferase, Glycine N-methyltransferase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for GNMT in ?

Tested Applications

Positive WB detected inrat liver tissue, mouse liver tissue, rat pancreas tissue, mouse pancreas tissue
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67294-1-Ig targets GNMT in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag4598

Product name: Recombinant human GNMT protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-295 aa of BC032627

Sequence: MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRTD

Predict reactive species
Full Name glycine N-methyltransferase
Calculated Molecular Weight 295 aa, 33 kDa
Observed Molecular Weight 33 kDa
GenBank Accession NumberBC032627
Gene Symbol GNMT
Gene ID (NCBI) 27232
RRIDAB_2882559
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ14749
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glycine N-methyltransferase (GNMT, EC 2.1.1.20) was found originally as an enzyme regulating the ratio of SAM to S-adenosyl- homocysteine. GNMT is conservative among different animal species. Glycine-N methyltransferase (GNMT) is a potential tumor suppressor that is commonly inactivated in human hepatoma. GNMT is abundant in liver, but very low in HepG2 cells (PMID: 12566990).

Protocols

Product Specific Protocols
IF protocol for GNMT antibody 67294-1-IgDownload protocol
WB protocol for GNMT antibody 67294-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The GNMT Monoclonal antibody (1B5E3), catalog number 67294-1-Ig, has 2 total citations. These appear in Frontiers in Oncology (gallbladder carcinoma, RNA methylation-related genes) and Cell Biochemistry and Biophysics (prostate cancer, glycine/sarcosine metabolic pathway). Both studies used human samples, with applications in IHC and WB respectively. The research fields span oncology and metabolic biology.

SpeciesApplicationTitle
humanIHC

Front Oncol

Mining of RNA Methylation-Related Genes and Elucidation of Their Molecular Biology in Gallbladder Carcinoma.

Authors - Changhong Yang
humanWB

Cell Biochem Biophys

Brucine Suppresses Malignant Progression of Prostate Cancer by Decreasing Sarcosine Accumulation via Downregulation of GNMT in the Glycine/sarcosine Metabolic Pathway

Authors - Long Miao

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

One user reviewed this antibody for Western Blot on mouse liver tissue at a 1:8000 dilution. They gave it a 5-star rating and described it as a great antibody with strong signal and clean background. Overall, the feedback is positive, highlighting reliable performance and good signal-to-noise ratio in WB applications.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Hua (Verified Customer) (11-11-2022)

Great antibody for WB. Strong signal and clean background.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:8000
  • Cell Tissue Type: Mouse liver
GNMT Antibody Western Blot validation (1:8000 dilution) in Mouse liver (Cat no:67294-1-Ig)
Loading...
||
New chat

Able™

正在加载,请稍候...