CoraLite® Plus 488-conjugated GNMT Monoclonal antibody

• 

  IF Staining of A431 using CL488-67294

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using CoraLite® Plus 488 GNMT antibody (CL488-67294, Clone: 1B5E3 ) at dilution of 1:200.

GNMT Monoclonal Antibody for IF/ICC

Cat No. CL488-67294

Clone No.1B5E3

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Pig, Rat

Applications

IF/ICC

Synonyms

glycine N methyltransferase, GNMT

---

Tested Applications

• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67294 targets GNMT in IF/ICC applications and shows reactivity with Human, Mouse, Pig, Rat samples.

• Tested Reactivity: Human, Mouse, Pig, Rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4598

  Product name: Recombinant human GNMT protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-295 aa of BC032627

  Sequence: MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRTD

• Full Name: glycine N-methyltransferase
• Calculated Molecular Weight: 295 aa, 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC032627
• Gene Symbol: GNMT
• Gene ID (NCBI): 27232
• RRID: AB_2934530
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q14749
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Glycine N-methyltransferase (GNMT, EC 2.1.1.20) was found originally as an enzyme regulating the ratio of SAM to S-adenosyl- homocysteine. GNMT is conservative among different animal species. Glycine-N methyltransferase (GNMT) is a potential tumor suppressor that is commonly inactivated in human hepatoma. GNMT is abundant in liver, but very low in HepG2 cells (PMID: 12566990).