GNMT Monoclonal antibody, PBS Only

• 

  WB analysis using 67294-1-Ig (same clone as 67294-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67294-1-Ig (GNMT antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67294-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig liver using 67294-1-Ig (same clone as 67294-1-PBS)

  pig liver tissue were subjected to SDS PAGE followed by western blot with 67294-1-Ig (GNMT antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67294-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat liver using 67294-1-Ig (same clone as 67294-1-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 67294-1-Ig (GNMT antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67294-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 67294-1-Ig (same clone as 67294-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 67294-1-Ig (GNMT antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67294-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 67294-1-Ig (same clone as 67294-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using GNMT antibody (67294-1-Ig, Clone: 1B5E3 ) at dilution of 1:800 and CoraLite®594-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67294-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 67294-1-Ig (same clone as 67294-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using GNMT antibody (67294-1-Ig, Clone: 1B5E3 ) at dilution of 1:800 and CoraLite®594-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67294-1-PBS in a different storage buffer formulation.

GNMT Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 67294-1-PBS

Clone No.1B5E3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

EC:2.1.1.20, glycine N methyltransferase, Glycine N-methyltransferase

---

Product Information

67294-1-PBS targets GNMT in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4598

  Product name: Recombinant human GNMT protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-295 aa of BC032627

  Sequence: MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRTD

• Full Name: glycine N-methyltransferase
• Calculated Molecular Weight: 295 aa, 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC032627
• Gene Symbol: GNMT
• Gene ID (NCBI): 27232
• RRID: AB_2882559
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14749
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Glycine N-methyltransferase (GNMT, EC 2.1.1.20) was found originally as an enzyme regulating the ratio of SAM to S-adenosyl- homocysteine. GNMT is conservative among different animal species. Glycine-N methyltransferase (GNMT) is a potential tumor suppressor that is commonly inactivated in human hepatoma. GNMT is abundant in liver, but very low in HepG2 cells (PMID: 12566990).