Tested Applications
| Positive WB detected in | A549 cells, HEK-293 cells, NIH/3T3 cells, HSC-T6 cells, K-562 cells, Jurkat cells, LNCaP cells, HeLa cells, 4T1 cells, HepG2 cells |
| Positive IF/ICC detected in | U2OS cells, HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67338-1-Ig targets PSMD9 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25654 Product name: Recombinant human PSMD9 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-102 aa of BC004213 Sequence: MSDEEARQSGGSSQAGVVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRSDVDLYQVRTARHNIICLQNDHKAVMKQVEEALHQLHA Predict reactive species |
| Full Name | proteasome (prosome, macropain) 26S subunit, non-ATPase, 9 |
| Calculated Molecular Weight | 27 kDa |
| Observed Molecular Weight | 25-30 kDa |
| GenBank Accession Number | BC004213 |
| Gene Symbol | PSMD9 |
| Gene ID (NCBI) | 5715 |
| RRID | AB_2882596 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | O00233 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PSMD9 is a ubiquitous protein of eukaryotic cells and is a chaperon of the 26S proteasome complex, which degrades ubiquitinated proteins in eukaryotic cells and contributes to the degradation of intracellular proteins into antigenic peptides for antigen presentation by MHC class I cells. The 26S mammalian base sub-complex involves three distinct modules which have ATPase subunits distinctly associated to three chaperones, one of which is PSMD9 regulating the modules assembly. The PSMD9 ubiquitous regulatory role within the proteasome implies its potential pleiotropic effects within different physio-pathological systems. PSMD9 is known to form a stable subcomplex with PSMC3 and PSMC6, two of the AAA-ATPases, assisting in the assembly of the 20S and 19S particles to form the holo complex.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for PSMD9 antibody 67338-1-Ig | Download protocol |
| IF protocol for PSMD9 antibody 67338-1-Ig | Download protocol |
| WB protocol for PSMD9 antibody 67338-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
CNS Neurosci Ther Comprehensive analysis of PSMD family members and validation of PSMD9 as a potential therapeutic target in human glioblastoma | ||
J Virol Swine RNF5 positively regulates the antiviral activity of IFITM1 by mediating the degradation of ABHD16A |











