Tested Applications
| Positive WB detected in | pig brain tissue, rat brain tissue, NCI-H1299 cells, mouse brain tissue, JAR cells |
| Positive IHC detected in | mouse heart tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:150-1:600 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67417-1-Ig targets ACVR1 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, Pig, Mouse, Rat samples.
| Tested Reactivity | Human, Pig, Mouse, Rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13508 Product name: Recombinant human ACVR1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 210-509 aa of BC033867 Sequence: LLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC Predict reactive species |
| Full Name | activin A receptor, type I |
| Calculated Molecular Weight | 509 aa, 57 kDa |
| Observed Molecular Weight | 57 kDa |
| GenBank Accession Number | BC033867 |
| Gene Symbol | ACVR1 |
| Gene ID (NCBI) | 90 |
| RRID | AB_2882657 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q04771 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ACVR1 (activin receptor type I), also known as ALK2 or ACTRI, is a receptor for activin. It forms a stable complex with type II receptor after ligand binding. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling, and type II receptors are required for binding ligands and for expression of type I receptors. ACVR1 is expressed in many tissues including skeletal muscle and chondrocytes. It functions as a receptor for bone morphogenetic protein (BMP) and induces Indian hedgehog in chondrocytes during skeletal development. Mutations in ACVR1 gene are associated with fibrodysplasia ossificans progressive (PMID: 16642017).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ACVR1 antibody 67417-1-Ig | Download protocol |
| IHC protocol for ACVR1 antibody 67417-1-Ig | Download protocol |
| WB protocol for ACVR1 antibody 67417-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ACVR1 Monoclonal antibody (Cat# 67417-1-Ig) has 10 total citations. These appear in journals including EMBO Journal, Neurobiology of Disease, International Immunopharmacology, Neuropharmacology, Journal of Cellular and Molecular Medicine, Frontiers in Molecular Biosciences, Laboratory Investigation, Molecular Immunology, Tissue & Cell, and European Journal of Histochemistry. Research fields span osteochondral differentiation, neuropathic pain, necrotizing enterocolitis, endothelial repair, bladder biology, odontogenic cysts, diabetic wound healing, osteoporosis, and BMP signaling.
| Species | Application | Title |
|---|---|---|
EMBO J GNAS/PKA signaling promotes aberrant osteochondral differentiation of Gli1+ tendon sheath progenitors | ||
Neurobiol Dis Neuronal ACVR1-mediated H3K18 lactylation drives NLRP3 pyroptosis to sustain neuropathic pain via metabolic-epigenetic coupling. | ||
Int Immunopharmacol Activin A exacerbates neonatal necrotizing enterocolitis via ALK4-mediated apoptosis and barrier disruption | ||
J Cell Mol Med Circulating exosomes repair endothelial cell damage by delivering miR-193a-5p. | ||
Neuropharmacology ACVR1 Drives Neuropathic Pain by Regulating NLRP3-Induced Neuronal Pyroptosis through the p38 and Smad1/5/8 Pathways | ||
Front Mol Biosci Expression and distribution of activin-follistatin-inhibin axis in the urinary bladder |
