ACVR1 Monoclonal antibody, PBS Only

• 

  WB analysis using 67417-1-Ig (same clone as 67417-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67417-1-Ig (ACVR1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67417-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 67417-1-Ig (same clone as 67417-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 67417-1-Ig (ACVR1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67417-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig brain using 67417-1-Ig (same clone as 67417-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67417-1-Ig (ACVR1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67417-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67417-1-Ig (same clone as 67417-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67417-1-Ig (ACVR1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67417-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 67417-1-Ig (same clone as 67417-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 67417-1-Ig (ACVR1 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67417-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 67417-1-Ig (same clone as 67417-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 67417-1-Ig (ACVR1 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67417-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67417-1-Ig (same clone as 67417-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67417-1-Ig (ACVR1 antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67417-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67417-1-Ig (same clone as 67417-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67417-1-Ig (ACVR1 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67417-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 67417-1-Ig (same clone as 67417-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using ACVR1 antibody (67417-1-Ig, Clone: 1F11B10 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67417-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 67417-1-Ig (same clone as 67417-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using ACVR1 antibody (67417-1-Ig, Clone: 1F11B10 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67417-1-PBS in a different storage buffer formulation.

ACVR1 Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 67417-1-PBS

Clone No.1F11B10

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Pig, Mouse, Rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

activin A receptor, type I, Activin receptor like kinase 2, Activin receptor type 1, Activin receptor type I, ACTR I, ACTRI, ACVR1, ACVR1A, ACVRLK2, ALK 2, ALK2, FOP, SKR1, TSR I, TSRI

---

Product Information

67417-1-PBS targets ACVR1 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with Human, Pig, Mouse, Rat samples.

• Tested Reactivity: Human, Pig, Mouse, Rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13508

  Product name: Recombinant human ACVR1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 210-509 aa of BC033867

  Sequence: LLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC

• Full Name: activin A receptor, type I
• Calculated Molecular Weight: 509 aa, 57 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC033867
• Gene Symbol: ACVR1
• Gene ID (NCBI): 90
• RRID: AB_2882657
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q04771
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ACVR1 (activin receptor type I), also known as ALK2 or ACTRI, is a receptor for activin. It forms a stable complex with type II receptor after ligand binding. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling, and type II receptors are required for binding ligands and for expression of type I receptors. ACVR1 is expressed in many tissues including skeletal muscle and chondrocytes. It functions as a receptor for bone morphogenetic protein (BMP) and induces Indian hedgehog in chondrocytes during skeletal development. Mutations in ACVR1 gene are associated with fibrodysplasia ossificans progressive (PMID: 16642017).