ACVR1 Monoclonal antibody, PBS Only

ACVR1 Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA
Cat No. 67417-1-PBS
Clone No.1F11B10

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Pig, Mouse, Rat

Applications

WB, IHC, IF-P, Indirect ELISA

activin A receptor, type I, Activin receptor like kinase 2, Activin receptor type 1, Activin receptor type I, ACTR I, ACTRI, ACVR1, ACVR1A, ACVRLK2, ALK 2, ALK2, FOP, SKR1, TSR I, TSRI

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67417-1-PBS targets ACVR1 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with Human, Pig, Mouse, Rat samples.

Tested Reactivity Human, Pig, Mouse, Rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag13508

Product name: Recombinant human ACVR1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 210-509 aa of BC033867

Sequence: LLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC

Predict reactive species
Full Name activin A receptor, type I
Calculated Molecular Weight 509 aa, 57 kDa
Observed Molecular Weight 57 kDa
GenBank Accession NumberBC033867
Gene Symbol ACVR1
Gene ID (NCBI) 90
RRIDAB_2882657
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ04771
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ACVR1 (activin receptor type I), also known as ALK2 or ACTRI, is a receptor for activin. It forms a stable complex with type II receptor after ligand binding. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling, and type II receptors are required for binding ligands and for expression of type I receptors. ACVR1 is expressed in many tissues including skeletal muscle and chondrocytes. It functions as a receptor for bone morphogenetic protein (BMP) and induces Indian hedgehog in chondrocytes during skeletal development. Mutations in ACVR1 gene are associated with fibrodysplasia ossificans progressive (PMID: 16642017).

Loading...
||
New chat

Able

正在加载,请稍候...