CoraLite® Plus 488-conjugated ACVR1 Monoclonal antibody

• 

  IF Staining of mouse brain using CL488-67417

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using CoraLite® Plus 488 ACVR1 antibody (CL488-67417, Clone: 1F11B10 ) at dilution of 1:200.

• 

  IF Staining of mouse brain using CL488-67417

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using CoraLite® Plus 488 ACVR1 antibody (CL488-67417, Clone: 1F11B10 ) at dilution of 1:200.

ACVR1 Monoclonal Antibody for IF-P

Cat No. CL488-67417

Clone No.1F11B10

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse

Applications

IF-P

Synonyms

activin A receptor, type I, Activin receptor like kinase 2, Activin receptor type 1, Activin receptor type I, ACTR I, ACTRI, ACVR1, ACVR1A, ACVRLK2, ALK 2, ALK2, FOP, SKR1, TSR I, TSRI

---

Tested Applications

• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67417 targets ACVR1 in IF-P applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13508

  Product name: Recombinant human ACVR1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 210-509 aa of BC033867

  Sequence: LLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC

• Full Name: activin A receptor, type I
• Calculated Molecular Weight: 509 aa, 57 kDa
• GenBank Accession Number: BC033867
• Gene Symbol: ACVR1
• Gene ID (NCBI): 90
• RRID: AB_2919468
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q04771
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

ACVR1 (activin receptor type I), also known as ALK2 or ACTRI, is a receptor for activin. It forms a stable complex with type II receptor after ligand binding. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling, and type II receptors are required for binding ligands and for expression of type I receptors. ACVR1 is expressed in many tissues including skeletal muscle and chondrocytes. It functions as a receptor for bone morphogenetic protein (BMP) and induces Indian hedgehog in chondrocytes during skeletal development. Mutations in ACVR1 gene are associated with fibrodysplasia ossificans progressive (PMID: 16642017).