Tested Applications
| Positive WB detected in | HT-29 cells, Caco-2 cells, human placenta tissue, NCCIT cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67439-1-Ig targets SOX9 in WB, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig, rabbit, canine |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28620 Product name: Recombinant human SOX9 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 209-509 aa of BC007951 Sequence: ADSPHSSSGMSEVHSPGEHSGQSQGPPTPPTTPKTDVQPGKADLKREGRPLPEGGRQPPIDFRDVDIGELSSDVISNIETFDVNEFDQYLPPNGHPGVPATHGQVTYTGSYGISSTAATPASAGHVWMSKQQAPPPPPQQPPQAPPAPQAPPQPQAAPPQQPAAPPQQPQAHTLTTLSSEPGQSQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP Predict reactive species |
| Full Name | SRY (sex determining region Y)-box 9 |
| Calculated Molecular Weight | 509 aa, 56 kDa |
| Observed Molecular Weight | 56 kDa |
| GenBank Accession Number | BC007951 |
| Gene Symbol | SOX9 |
| Gene ID (NCBI) | 6662 |
| RRID | AB_2882675 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P48436 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SOX9, also named as Transcription factor SOX-9, is a 509 amino acid protein. Sex-determining region Y (SRY)-box 9 protein (SOX9) is a member of the SOX family of transcription factors (TFs) which are developmental regulators that possess high mobility group (HMG) box DNA binding and transactivation domains. It participates in a variety of functions, such as lineage restriction and terminal diferentiation, through precise temporal and spatial expression patterns that difer between particular cell types and tissues. SOX9 gene has been implicated in different types of cancer as an oncogene; however, it also may behave as a tumor suppressor.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for SOX9 antibody 67439-1-Ig | Download protocol |
| WB protocol for SOX9 antibody 67439-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-SOX9 antibody (Cat# 67439-1-Ig) has accumulated 138 citations published in high-impact journals including Nature, Advanced Materials, Biomaterials, Science Translational Medicine, Theranostics, Advanced Science, Materials Today Bio, Free Radical Biology and Medicine, Cell Death Discovery, FASEB Journal, and Communications Biology. Key research fields include osteoarthritis and cartilage regeneration, intervertebral disc degeneration, ferroptosis, NF-κB inflammatory signaling, chondrogenic differentiation, tissue engineering and biomaterials, and oncology spanning hepatocellular carcinoma, glioma, colorectal cancer, and pancreatic cancer.
| Species | Application | Title |
|---|---|---|
Adv Mater Mechano-Iontronic Hydrogels Generating Biomimetic Endogenous Bioelectricity for Promoting Cartilage Regeneration. | ||
Bioact Mater Promoting chondrogenesis by targeted delivery to the degenerating cartilage in early treatment of osteoarthritis | ||
Bioact Mater Synergizing adaptive immunity and regenerative signals to enhance osteochondral defects repair | ||
Bioact Mater A dual-functional hydrogel integrating adhesive and lubricating interfaces for mitochondrial protection-Driven cartilage regeneration. | ||
Bioact Mater Controlled TPCA-1 delivery engineers a pro-tenogenic niche to initiate tendon regeneration by targeting IKKβ/NF-κB signaling |
Reviews
What customers say
Most reviewers rate this antibody highly (5/5), praising its performance in Western blot, immunohistochemistry, and immunofluorescence on colon cancer cells and tissues at dilutions of 1:100–1:1000. One reviewer (3/5) used it for IHC on human PDX models in mouse femur and PC3 cell lines; while the positive control showed good signal, PDX samples yielded weaker staining, possibly due to decalcification or sample processing. They plan to retry with a higher antibody concentration. Overall, users report reliable results across multiple applications with standard protocols.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Iram (Verified Customer) (03-23-2026) | Very good antibody
|
MALLIKARJUNA (Verified Customer) (11-28-2025) | WORKS GOOD FOR WESTERN BLOT
|
Iram (Verified Customer) (09-18-2025) | Very good antibody for IB, IHC and IF.
|
Agustina (Verified Customer) (09-13-2025) | With this dilution the cells included as positive control (PC3 cells) had a good signal, however not much in the PDXs, even though it seems some was there (could be related with decalcification or other sample processing steps). I will try increasing the antibody concentration.
|
