Tested Applications
| Positive WB detected in | HeLa cells, A549 cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells |
| Positive IHC detected in | mouse brain tissue, human lung cancer tissue, human urothelial carcinoma tissue, human oesophagus cancer tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse testis tissue |
| Positive FC (Intra) detected in | HEK-293 cells |
This antibody is not recommended for immunocytofluorescent assays.
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67733-1-Ig targets METTL3 in WB, IHC, IF-P, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7110 Product name: Recombinant human METTL3 protein Source: e coli.-derived, T-HIS Tag: 6*His Domain: 229-580 aa of BC001650 Sequence: LNQQSTKEQQSKKVSQEILELLNTTTAKEQSIVEKFRSRGRAQVQEFCDYGTKEECMKASDADRPCRKLHFRRIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACMDSEAPGSKDHTPSQELALTQSVGGDSSADRLFPPQWICCDIRYLDVSILGKFAVVMADPPWDIHMELPYGTLTDDEMRRLNIPVLQDDGFLFLWVTGRAMELGRECLNLWGYERVDEIIWVKTNQLQRIIRTGRTGHWLNHGKEHCLVGVKGNPQGFNQGLDCDVIVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNVQPNWITLGNQLDGIHLLDPDVVARFKQRYPDGIISKPKNL Predict reactive species |
| Full Name | methyltransferase like 3 |
| Calculated Molecular Weight | 64 kDa |
| Observed Molecular Weight | 65-70 kDa |
| GenBank Accession Number | BC001650 |
| Gene Symbol | METTL3 |
| Gene ID (NCBI) | 56339 |
| RRID | AB_2918502 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q86U44 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
METTL3 is a key S-adenosyl-L-methionine-binding subunit, which is component of a complex multicomponent enzyme that catalyzes the methylation of internal adenosine residues in eukaryotic mRNA, forming N6-methyladenosine. It contains 2 putative nuclear localization signals and 2 consensus methylation motifs. The calculated molecular weight of METTL3 is 64 kDa, but modified METTL3 is about 65-70 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for METTL3 antibody 67733-1-Ig | Download protocol |
| IF protocol for METTL3 antibody 67733-1-Ig | Download protocol |
| IHC protocol for METTL3 antibody 67733-1-Ig | Download protocol |
| WB protocol for METTL3 antibody 67733-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The METTL3 Monoclonal antibody (Cat# 67733-1-Ig) has 41 citations across journals including Cancer Research, Autophagy, Nucleic Acids Research, Advanced Science, Cell Death & Disease, Cell Reports, EMBO Reports, iScience, Cancer Letters, and Atherosclerosis. Research fields span m6A RNA methylation, cancer biology (glioblastoma, colorectal, breast, bladder, and oral cancers), ferroptosis, autophagy, cardiovascular disease, atherosclerosis, pulmonary fibrosis, neuroinflammation, immune regulation, and stem cell biology.
| Species | Application | Title |
|---|---|---|
Cancer Res METTL3 Methylation Induces Decay of Endogenous Retroelement Transcripts to Promote Tumor Immune Evasion.
| ||
Autophagy METTL3-dependent m6A modification of SNAP29 induces "autophagy-mitochondrial crisis" in the ischemic microenvironment after soft tissue transplantation | ||
Adv Sci (Weinh) Elevated Histone Lactylation Mediates Ferroptosis Resistance in Endometriosis Through the METTL3-Regulated HIF1A/HMOX1 Signaling Pathway | ||
Cell Death Dis Intracellular C5aR1 inhibits ferroptosis in glioblastoma through METTL3-dependent m6A methylation of GPX4
| ||
Cell Death Dis SALL4 promotes cancer stem-like cell phenotype and radioresistance in oral squamous cell carcinomas via methyltransferase-like 3-mediated m6A modification |
