METTL3 Monoclonal antibody, PBS Only

• 

  WB analysis using 67733-1-Ig (same clone as 67733-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67733-1-Ig (METTL3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 67733-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 67733-1-Ig (same clone as 67733-1-PBS)

  WB result of METTL3 antibody (67733-1-Ig; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-METTL3 transfected A549 cells. This data was developed using the same antibody clone with 67733-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67733-1-Ig (same clone as 67733-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67733-1-Ig (METTL3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67733-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67733-1-Ig (same clone as 67733-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67733-1-Ig (METTL3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67733-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 67733-1-Ig (same clone as 67733-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67733-1-Ig (METTL3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67733-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 67733-1-Ig (same clone as 67733-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67733-1-Ig (METTL3 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67733-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 67733-1-Ig (same clone as 67733-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67733-1-Ig (METTL3 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67733-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat testis using 67733-1-Ig (same clone as 67733-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 67733-1-Ig (METTL3 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67733-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat testis using 67733-1-Ig (same clone as 67733-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 67733-1-Ig (METTL3 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67733-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67733-1-Ig (same clone as 67733-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67733-1-Ig (METTL3 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67733-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67733-1-Ig (same clone as 67733-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67733-1-Ig (METTL3 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67733-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human oesophagus cancer using 67733-1-Ig (same clone as 67733-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 67733-1-Ig (METTL3 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67733-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human oesophagus cancer using 67733-1-Ig (same clone as 67733-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 67733-1-Ig (METTL3 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67733-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human urothelial carcinoma using 67733-1-Ig (same clone as 67733-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 67733-1-Ig (METTL3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67733-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human urothelial carcinoma using 67733-1-Ig (same clone as 67733-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 67733-1-Ig (METTL3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67733-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 67733-1-Ig (same clone as 67733-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67733-1-Ig (METTL3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67733-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse testis using 67733-1-Ig (same clone as 67733-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using METTL3 antibody (67733-1-Ig, Clone: 2D8H1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67733-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse testis using 67733-1-Ig (same clone as 67733-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using METTL3 antibody (67733-1-Ig, Clone: 2D8H1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67733-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HEK-293 using 67733-1-Ig (same clone as 67733-1-PBS)

  1X10^6 HEK-293 cells were intracellularly stained with 0.4 ug Anti-Human METTL3 (67733-1-Ig, Clone:2D8H1) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 67733-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

METTL3 Monoclonal Antibody for WB, IHC, IF-P, FC (Intra), Indirect ELISA

Cat No. 67733-1-PBS

Clone No.2D8H1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF-P, FC (Intra), Indirect ELISA

Synonyms

2D8H1, EC:2.1.1.348, hMETTL3, Methyltransferase-like protein 3, MT A70

---

This antibody is not recommended for immunocytofluorescent assays.

Product Information

67733-1-PBS targets METTL3 in WB, IHC, IF-P, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7110

  Product name: Recombinant human METTL3 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 229-580 aa of BC001650

  Sequence: LNQQSTKEQQSKKVSQEILELLNTTTAKEQSIVEKFRSRGRAQVQEFCDYGTKEECMKASDADRPCRKLHFRRIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACMDSEAPGSKDHTPSQELALTQSVGGDSSADRLFPPQWICCDIRYLDVSILGKFAVVMADPPWDIHMELPYGTLTDDEMRRLNIPVLQDDGFLFLWVTGRAMELGRECLNLWGYERVDEIIWVKTNQLQRIIRTGRTGHWLNHGKEHCLVGVKGNPQGFNQGLDCDVIVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNVQPNWITLGNQLDGIHLLDPDVVARFKQRYPDGIISKPKNL

• Full Name: methyltransferase like 3
• Calculated Molecular Weight: 64 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC001650
• Gene Symbol: METTL3
• Gene ID (NCBI): 56339
• RRID: AB_2918502
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q86U44
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

METTL3 is a key S-adenosyl-L-methionine-binding subunit, which is component of a complex multicomponent enzyme that catalyzes the methylation of internal adenosine residues in eukaryotic mRNA, forming N6-methyladenosine. It contains 2 putative nuclear localization signals and 2 consensus methylation motifs. The calculated molecular weight of METTL3 is 64 kDa, but modified METTL3 is about 65-70 kDa.