HRP-conjugated METTL3 Monoclonal antibody

• 

  WB analysis of HeLa using HRP-67733

  HeLa cells were subjected to SDS PAGE followed by western blot with HRP-67733 (METTL3 antibody) at dilutions of 1:5000, 1:10000 and 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using HRP-67733

  HeLa cells were subjected to SDS PAGE followed by western blot with HRP-67733 (METTL3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

METTL3 Monoclonal Antibody for WB

Cat No. HRP-67733

Clone No.2D8H1

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse

Applications

WB

Synonyms

IME4, M6A, methyltransferase like 3, METTL3, MT A70, MTA70, Spo8

---

Tested Applications

• Positive WB detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

HRP-67733 targets METTL3 in WB applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7110

  Product name: Recombinant human METTL3 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 229-580 aa of BC001650

  Sequence: LNQQSTKEQQSKKVSQEILELLNTTTAKEQSIVEKFRSRGRAQVQEFCDYGTKEECMKASDADRPCRKLHFRRIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACMDSEAPGSKDHTPSQELALTQSVGGDSSADRLFPPQWICCDIRYLDVSILGKFAVVMADPPWDIHMELPYGTLTDDEMRRLNIPVLQDDGFLFLWVTGRAMELGRECLNLWGYERVDEIIWVKTNQLQRIIRTGRTGHWLNHGKEHCLVGVKGNPQGFNQGLDCDVIVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNVQPNWITLGNQLDGIHLLDPDVVARFKQRYPDGIISKPKNL

• Full Name: methyltransferase like 3
• Calculated Molecular Weight: 64 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC001650
• Gene Symbol: METTL3
• Gene ID (NCBI): 56339
• RRID: AB_2920513
• Conjugate: HRP
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q86U44
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

METTL3 is a key S-adenosyl-L-methionine-binding subunit, which is component of a complex multicomponent enzyme that catalyzes the methylation of internal adenosine residues in eukaryotic mRNA, forming N6-methyladenosine. It contains 2 putative nuclear localization signals and 2 consensus methylation motifs. The calculated molecular weight of METTL3 is 64 kDa, but modified METTL3 is about 65-70 kDa.