Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

AHR Monoclonal antibody

AHR Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 67785-1-Ig
Clone No.2D1F9

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Class E basic helix-loop-helix protein 76, bHLHe76, Ah receptor, 2D1F9

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite®594
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, LNCaP cells, MCF-7 cells, HEK-293 cells, HSC-T6 cells, 4T1 cells, PC-3 cells, HeLa cells, Caco-2 cells, HepG2 cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman breast cancer tissue, mouse testis tissue
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:200-1:500
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67785-1-Ig targets AHR in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, zebrafish
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28935

Product name: Recombinant human AHR protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 25-300 aa of BC070080

Sequence: PIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPSQCTESGQGIEEATGLPQTVVCYNPDQIPPENSPLMERCFICRLRCLLDNSSGFLAMNFQGKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGC

Predict reactive species
Full Name aryl hydrocarbon receptor
Calculated Molecular Weight 848 aa, 96 kDa
Observed Molecular Weight105-110 kDa
GenBank Accession NumberBC070080
Gene Symbol AHR
Gene ID (NCBI) 196
RRIDAB_2918549
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP35869
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The aryl hydrocarbon receptor (AhR) is a ligand-activated transcription factor that has been largely regarded as a mediator of xenobiotic metabolism [PMID:18483242]. It plays a part role in physiologic activities, including attenuation of the acute phase response, cytokine signaling, T helper (TH)17 immune cell differentiation, modulation of NF-κB activity, and regulation of hormonal signaling [PMID:20423157,18540824]. It also mediates transcription factor sequestering away from a gene promoter or tethering of the AhR to a transcription factor on a promoter. AHR calculated molecular masses differ by <10%, compared with the apparent molecular masses predicted from SDS-PAGE for the two receptors (105 and 95 kDa, respectively). (PMID: 8246913)

Protocols

Product Specific Protocols
IF protocol for AHR antibody 67785-1-IgDownload protocol
IHC protocol for AHR antibody 67785-1-IgDownload protocol
WB protocol for AHR antibody 67785-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseWB

NPJ Regen Med

Aryl hydrocarbon receptor regulates IL-22 receptor expression on thymic epithelial cell and accelerates thymus regeneration

Authors - Jingyi Shen
humanWB,IF

Phytother Res

Quercetin ameliorates ulcerative colitis by activating aryl hydrocarbon receptor to improve intestinal barrier integrity

Authors - Xiaojing Wang

Cell Rep

Hypoxia-induced PRMT1 methylates HIF2β to promote breast tumorigenesis via enhancing glycolytic gene transcription

Authors - Wen-Juan Li
mouseIF

Ecotoxicol Environ Saf

Hesperetin protects hippocampal neurons from the neurotoxicity of Aflatoxin B1 in mice

Authors - Chao Song
ratWB

Biomater Sci

Glioma-targeted multifunctional nanoparticles to co-deliver camptothecin and curcumin for enhanced chemo-immunotherapy.

Authors - Zian Wang
mouseWB,IF

iScience

StemRegenin 1 attenuates the RANKL-induced osteoclastogenesis via inhibiting AhR-c-src-NF-κB/p-ERK MAPK-NFATc1 signaling pathway

Authors - Shengji Zhou

Reviews

    5.0 out of 5
Add a review

3 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Mounika (Verified Customer) (01-08-2026)

very very nice antibodies, happy to them in our lab. Does wonders!!

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:1000

Rashmi (Verified Customer) (10-13-2025)

The antibody worked well (1:100 dilution) with IFA on paraffin-embedded mouse lung tissue.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Lung
AHR Antibody Immunofluorescence validation (1:100 dilution) in Lung (Cat no:67785-1-Ig)

Bartosz (Verified Customer) (02-09-2023)

Perfect Abs, the bands are clear and very strong, even in case of small of amount of protein, loaded into gel (20 ug). Just perfect, highly recommend.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: SH-SY5Y cells; A549 cells; CACO-2 cells; BJ cells
Loading...
||
New chat

Able

正在加载,请稍候...