Tested Applications
| Positive WB detected in | A549 cells, LNCaP cells, MCF-7 cells, HEK-293 cells, HSC-T6 cells, 4T1 cells, PC-3 cells, HeLa cells, Caco-2 cells, HepG2 cells |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67785-1-Ig targets AHR in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, zebrafish |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28935 Product name: Recombinant human AHR protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 25-300 aa of BC070080 Sequence: PIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPSQCTESGQGIEEATGLPQTVVCYNPDQIPPENSPLMERCFICRLRCLLDNSSGFLAMNFQGKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGC Predict reactive species |
| Full Name | aryl hydrocarbon receptor |
| Calculated Molecular Weight | 848 aa, 96 kDa |
| Observed Molecular Weight | 105-110 kDa |
| GenBank Accession Number | BC070080 |
| Gene Symbol | AHR |
| Gene ID (NCBI) | 196 |
| RRID | AB_2918549 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P35869 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The aryl hydrocarbon receptor (AhR) is a ligand-activated transcription factor that has been largely regarded as a mediator of xenobiotic metabolism [PMID:18483242]. It plays a part role in physiologic activities, including attenuation of the acute phase response, cytokine signaling, T helper (TH)17 immune cell differentiation, modulation of NF-κB activity, and regulation of hormonal signaling [PMID:20423157,18540824]. It also mediates transcription factor sequestering away from a gene promoter or tethering of the AhR to a transcription factor on a promoter. AHR calculated molecular masses differ by <10%, compared with the apparent molecular masses predicted from SDS-PAGE for the two receptors (105 and 95 kDa, respectively). (PMID: 8246913)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for AHR antibody 67785-1-Ig | Download protocol |
| WB protocol for AHR antibody 67785-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The AHR Monoclonal antibody (Cat# 67785-1-Ig) has 136 citations published across over 90 journals, including Signal Transduction and Targeted Therapy, Microbiome, Advanced Science, Phytomedicine, Oncogene, Cell Reports, FASEB Journal, Cell Metabolism, and Theranostics. Key research fields span gut microbiota–tryptophan metabolism, cancer biology and immunotherapy, neurodegeneration, environmental toxicology, metabolic and cardiovascular diseases, bone/joint disorders, pulmonary pathology, and autoimmune conditions. The antibody is primarily validated by Western blot, with immunofluorescence and immunohistochemistry also widely represented.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Inducible CD147 up-regulation boosts extended SARS-CoV-2 infection triggering severe COVID-19 independent of ACE2. | ||
Cancer Commun (Lond) Metabolic landscape of head and neck squamous cell carcinoma informs a novel kynurenine/Siglec-15 axis in immune escape | ||
Exp Mol Med Proline/serine-rich coiled-coil 1 alleviates atherosclerosis via remodeling tryptophan metabolism mediated by Akkermansia muciniphila. | ||
Redox Biol Aryl hydrocarbon receptor in club cells drives Th17-mediated lung injury following inhalation exposure to environmentally persistent free radicals. | ||
Gut Microbes Microbiota-derived I3A protects the intestine against radiation injury by activating AhR/IL-10/Wnt signaling and enhancing the abundance of probiotics | ||
Microbiome Tumor-colonized Streptococcus mutans metabolically reprograms tumor microenvironment and promotes oral squamous cell carcinoma |
Reviews
What customers say
All three reviews are 5-star ratings. Users report excellent performance across Western Blot, immunohistochemistry, and immunofluorescence. One user found clear, strong bands even with low protein loading (20 µg) at a 1:3000 dilution in multiple cell lines. Another confirmed reliable IFA results on paraffin-embedded mouse lung tissue at 1:100. A third praised the antibody's versatility at 1:1000 for WB, IHC, and IF. Overall, reviewers describe the antibody as highly sensitive, specific, and easy to use, with strong recommendations.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Mounika (Verified Customer) (01-08-2026) | very very nice antibodies, happy to them in our lab. Does wonders!!
|
Rashmi (Verified Customer) (10-13-2025) | The antibody worked well (1:100 dilution) with IFA on paraffin-embedded mouse lung tissue.
 |
Bartosz (Verified Customer) (02-09-2023) | Perfect Abs, the bands are clear and very strong, even in case of small of amount of protein, loaded into gel (20 ug). Just perfect, highly recommend.
|
