Tested Applications
| Positive WB detected in | rabbit brain tissue, PC-12 cells, pig brain tissue, rat brain tissue, mouse brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U-87 MG cells, SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67822-1-Ig targets VAMP2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
| Tested Reactivity | human, mouse, rat, pig, rabbit |
| Cited Reactivity | mouse |
| Host / Isotype | Mouse / IgG3 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17908 Product name: Recombinant human VAMP2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-116 aa of BC002737 Sequence: MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST Predict reactive species |
| Full Name | vesicle-associated membrane protein 2 (synaptobrevin 2) |
| Calculated Molecular Weight | 13 kDa |
| Observed Molecular Weight | 19 kDa |
| GenBank Accession Number | BC002737 |
| Gene Symbol | VAMP2 |
| Gene ID (NCBI) | 6844 |
| RRID | AB_2918585 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P63027 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
VAMP2 (vesicle-associated membrane protein 2), also named as synaptobrevin 2, is a member of the SNARE (soluble NSF-attachment protein receptor) family of proteins. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP2, with a molecular mass of 15-19 kDa, consists of a short N-terminal sequence, a SNARE motif, and a C-terminal transmembrane region. It is required for fast calcium-triggered synaptic vesicle fusion. VAMP2 forms a stable complex with STX1 (syntaxin 1) and SNAP25 (synaptosomal-associated protein 25) during synaptic vesicle fusion (PMID: 16793874). It also forms a distinct complex with synaptophysin. VAMP2 is expressed in nervous system and some non-neuronal tissues, such as skeletal muscle (PMID: 18570252).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for VAMP2 antibody 67822-1-Ig | Download protocol |
| IHC protocol for VAMP2 antibody 67822-1-Ig | Download protocol |
| WB protocol for VAMP2 antibody 67822-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The VAMP2 Monoclonal antibody (1G7E8), catalog number 67822-1-Ig, has a total of 2 citations. These appear in Nature Protocols (2025) and Advanced Science (2026). The cited research fields include protein dynamics and membrane fusion (planar asymmetric suspended membranes) and metabolic biology (adipocyte-derived leptolin, energy expenditure, and obesity prevention). The antibody was applied in immunofluorescence (IF) in the mouse species context.
| Species | Application | Title |
|---|---|---|
Nat Protoc Highly stable planar asymmetric suspended membranes for investigating protein dynamics and membrane fusion | ||
Adv Sci (Weinh) Adipocyte-Derived Leptolin Enhances Energy Expenditure and Prevents Obesity. |
Reviews
What customers say
The single review for this product is highly positive (5/5). The user performed immunofluorescence on primary hippocampal neurons at a 1:500 dilution and reported that the antibody showed very specific staining with minimal background. Overall, the feedback highlights excellent specificity and low background in cell culture IF applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Michela (Verified Customer) (06-20-2024) | The immunofluorescence was carried out in primary hippocampal neurons with an antibody dilution of 1:500. The antibody appears to be very specific and with minimal background staining.
|
