Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Importin Alpha 5 Monoclonal antibody

Importin Alpha 5 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67897-1-Ig
Clone No. 2A7G7
Publications (1)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA
For FC, select conjugated version.

IMA5, KPNA1, 2A7G7, Importin subunit alpha 1, Importin subunit alpha-5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Importin Alpha 5 in ?

Tested Applications

Positive WB detected inHCT 116 cells, HSC-T6 cells, 4T1 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, PC-12 cells, NIH/3T3 cells
Positive IHC detected inmouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67897-1-Ig targets Importin Alpha 5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag12751

Product name: Recombinant human KPNA1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 19-272 aa of BC002374

Sequence: LNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLA

Predict reactive species
Full Name karyopherin alpha 1 (importin alpha 5)
Calculated Molecular Weight 60 kDa
Observed Molecular Weight60-62 kDa
GenBank Accession NumberBC002374
Gene Symbol Importin Alpha 5
Gene ID (NCBI) 3836
RRIDAB_2918653
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP52294
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Importins (alpha and beta) are transport factors that transport proteins into the nucleus. alpha importins function by binding transcription factors at nuclear localization sequences (NLS), and associating with importin beta subunits to translocate through the nuclear pore. Six isoforms of alpha importins have been described in human. Importin alpha 5 is the predominant importin in adult CNS and is essential for differentiation and viability of neural cells.

Protocols

Product Specific Protocols
IF protocol for Importin Alpha 5 antibody 67897-1-IgDownload protocol
IHC protocol for Importin Alpha 5 antibody 67897-1-IgDownload protocol
WB protocol for Importin Alpha 5 antibody 67897-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The Importin Alpha 5 Monoclonal antibody (2A7G7), catalog number 67897-1-Ig, has a total of 1 citation. The citation appears in bioRxiv (2024), where the antibody was used for immunofluorescence (IF) in human samples. The associated research field is cell biology, specifically investigating how palmitoylated Importin α regulates mitotic spindle orientation through its interaction with NuMA.

SpeciesApplicationTitle
humanIF

bioRxiv

Palmitoylated Importin α Regulates Mitotic Spindle Orientation Through Interaction with NuMA

Authors - Patrick James Sutton
Loading...
||
New chat

Able™

正在加载,请稍候...