Importin Alpha 5 Monoclonal antibody, PBS Only

• 

  WB analysis using 67897-1-Ig (same clone as 67897-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67897-1-Ig (KPNA1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control. This data was developed using the same antibody clone with 67897-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67897-1-Ig (same clone as 67897-1-PBS)

  WB result of Importin Alpha 5 antibody (67897-1-Ig; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Importin Alpha 5 transfected HeLa cells. This data was developed using the same antibody clone with 67897-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67897-1-Ig (same clone as 67897-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67897-1-Ig (KPNA1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67897-1-PBS in a different storage buffer formulation.

• 

  WB analysis of 4T1 using 67897-1-Ig (same clone as 67897-1-PBS)

  4T1 cells were subjected to SDS PAGE followed by western blot with 67897-1-Ig (KPNA1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67897-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 67897-1-Ig (same clone as 67897-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 67897-1-Ig (Importin Alpha 5 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67897-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 67897-1-Ig (same clone as 67897-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using Importin Alpha 5 antibody (67897-1-Ig, Clone: 2A7G7 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 67897-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 67897-1-Ig (same clone as 67897-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using Importin Alpha 5 antibody (67897-1-Ig, Clone: 2A7G7 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 67897-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Importin Alpha 5 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67897-1-PBS

Clone No.2A7G7

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Importin subunit alpha 1, IPOA5, Karyopherin subunit alpha 1, KPNA1, Nucleoprotein interactor 1, RAG cohort protein 2, RCH2, SRP1, SRP1 beta

---

Product Information

67897-1-PBS targets Importin Alpha 5 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12751

  Product name: Recombinant human KPNA1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 19-272 aa of BC002374

  Sequence: LNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLA

• Full Name: karyopherin alpha 1 (importin alpha 5)
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 60-62 kDa
• GenBank Accession Number: BC002374
• Gene Symbol: Importin Alpha 5
• Gene ID (NCBI): 3836
• RRID: AB_2918653
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P52294
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Importins (alpha and beta) are transport factors that transport proteins into the nucleus. alpha importins function by binding transcription factors at nuclear localization sequences (NLS), and associating with importin beta subunits to translocate through the nuclear pore. Six isoforms of alpha importins have been described in human. Importin alpha 5 is the predominant importin in adult CNS and is essential for differentiation and viability of neural cells.