Tested Applications
| Positive WB detected in | LNCaP cells, MDA-MB-231 cells, NIH/3T3 cells, HeLa cells, Jurkat cells, K-562 cells, HUVEC cells, mouse brain tissue |
| Positive IHC detected in | mouse brain tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
68111-1-Ig targets FTO in WB, IHC, FC (Intra), RIP, ELISA applications and shows reactivity with human, mouse, pig samples.
| Tested Reactivity | human, mouse, pig |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26095 Product name: Recombinant human FTO protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 400-505 aa of NM_001080432 Sequence: MAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMPLPFDLTDIVSELRGQLLEAKP Predict reactive species |
| Full Name | fat mass and obesity associated |
| Calculated Molecular Weight | 58 kDa |
| Observed Molecular Weight | 58 kDa |
| GenBank Accession Number | NM_001080432 |
| Gene Symbol | FTO |
| Gene ID (NCBI) | 79068 |
| RRID | AB_2923640 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9C0B1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Fat mass and obesity-associated protein (FTO) has efficient oxidative demethylation activity targeting the abundant N6-methyladenosine (m6A) residues in RNA in vitro. Variants in the FTO (fat mass and obesity associated) gene are associated with increased body mass index in humans.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for FTO antibody 68111-1-Ig | Download protocol |
| IHC protocol for FTO antibody 68111-1-Ig | Download protocol |
| WB protocol for FTO antibody 68111-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
FTO Monoclonal antibody (1E8B1), catalog number 68111-1-Ig, has 10 citations published in J Nanobiotechnology, Apoptosis, Int J Biol Macromol, Front Immunol, Ecotoxicol Environ Saf, Acta Physiol, Noncoding RNA Res, Acta Biochim Biophys Sin, BBA Mol Cell Res, and Drug Metab Dispos. Research fields include m6A RNA modification, oncology (melanoma, breast, pancreatic, oral cancers), cardiovascular biology, ecotoxicology, and dermatology.
| Species | Application | Title |
|---|---|---|
J Nanobiotechnology Peptide-modified phase-transition nanoparticles co-deliver FTO siRNA and Ce6 for sonodynamic metabolism-immunotherapy of melanoma | ||
Apoptosis NRP1 contributes to stemness and potentiates radioresistance via WTAP-mediated m6A methylation of Bcl-2 mRNA in breast cancer | ||
Int J Biol Macromol METTL3 enhances E. coli F18 resistance by targeting IKBKG/NF-κB signaling via an m6A-YTHDF1-dependent manner in IPEC-J2 cells | ||
Front Immunol m6A epigenetic signature in necrotizing enterocolitis: insights from murine to neonatal studies. | ||
Ecotoxicol Environ Saf Changes of N(6)-methyladenosine modification and unfolded protein response in renal cell injury induced by cadmium. | ||
Acta Physiol (Oxf) Landscape of transcriptome-wide m6A modification in diabetic liver reveals rewiring of PI3K-Akt signaling after physical exercise |
