Filter: AllWBIHCFC (Intra)

WB analysis using 68111-1-Ig (same clone as 68111-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 68111-1-Ig (FTO antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68111-1-PBS in a different storage buffer formulation.
WB analysis of MDA-MB-231 using 68111-1-Ig (same clone as 68111-1-PBS)
WB result of FTO antibody (68111-1-Ig; 1:3000; room temperature for 1.5 hours) with wild-type and FTO knockout MDA-MB-231 cells. This data was developed using the same antibody clone with 68111-1-PBS in a different storage buffer formulation.
WB analysis of NIH/3T3 using 68111-1-Ig (same clone as 68111-1-PBS)
NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 68111-1-Ig (FTO antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68111-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 68111-1-Ig (same clone as 68111-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68111-1-Ig (FTO antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68111-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 68111-1-Ig (same clone as 68111-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 68111-1-Ig (FTO antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68111-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 68111-1-Ig (same clone as 68111-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 68111-1-Ig (FTO antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68111-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 68111-1-Ig (same clone as 68111-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68111-1-Ig (FTO antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68111-1-PBS in a different storage buffer formulation.
FC experiment of SH-SY5Y using 68111-1-Ig (same clone as 68111-1-PBS)
1X10^6 SH-SY5Y cells were intracellularly stained with 0.4 ug Anti-Human FTO (68111-1-Ig, Clone:1E8B1) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2b Isotype Control (MPC-11) (65128-1-Ig, Clone: MPC-11) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 68111-1-PBS in a different storage buffer formulation.
×
1X10^6 SH-SY5Y cells were intracellularly stained with 0.4 ug Anti-Human FTO (68111-1-Ig, Clone:1E8B1) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2b Isotype Control (MPC-11) (65128-1-Ig, Clone: MPC-11) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 68111-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

FTO Monoclonal antibody, PBS Only

FTO Monoclonal Antibody for WB, IHC, FC (Intra), Indirect ELISA

Cat No. 68111-1-PBS

Clone No.1E8B1

Review Product

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, pig

Applications

WB, IHC, FC (Intra), Indirect ELISA

Synonyms

1E8B1, KIAA1752

Formulation: PBS Only

PBS and Azide

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

68111-1-PBS targets FTO in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, pig samples.

Tested Reactivity	human, mouse, pig
Host / Isotype	Mouse / IgG2b
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag26095 Product name: Recombinant human FTO protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 400-505 aa of NM_001080432 Sequence: MAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMPLPFDLTDIVSELRGQLLEAKP Predict reactive species
Full Name	fat mass and obesity associated
Calculated Molecular Weight	58 kDa
Observed Molecular Weight	58 kDa
GenBank Accession Number	NM_001080432
Gene Symbol	FTO
Gene ID (NCBI)	79068
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q9C0B1
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Fat mass and obesity-associated protein (FTO) has efficient oxidative demethylation activity targeting the abundant N6-methyladenosine (m6A) residues in RNA in vitro. Variants in the FTO (fat mass and obesity associated) gene are associated with increased body mass index in humans.