ECM1 Monoclonal antibody, PBS Only (Capture)

ECM1 Monoclonal Antibody for WB, IHC, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 68472-1-PBS
Clone No.2D1A3

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, Sandwich ELISA, Indirect ELISA, Sample test

2D1A3, extracellular matrix protein 1, Secretory component p85

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68472-1-PBS targets ECM1 as part of a matched antibody pair:

MP50074-1: 68472-1-PBS capture and 66023-1-PBS detection (validated in Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Eg0533

Product name: Recombinant Human ECM1 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 20-540 aa of BC023505

Sequence: ASEGGFTATGQRQLRPEHFQEVGYAAPPSPPLSRSLPMDHPDSSQHGPPFEGQSQVQPPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQEAVPLQKELPSLQHPNEQKEGMPAPFGDQSHPEPESWNAAQHCQQDRSQGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSHLTRQGETLNFLEIGYSRCCHCRSHTNRLECAKLVWEEAMSRFCEAEFSVKTRPHWCCTRQGEARFSCFQEEAPQPHYQLRACPSHQPDISSGLELPFPPGVPTLDNIKNICHLRRFRSVPRNLPATDPLQRELLALIQLEREFQRCCRQGNNHTCTWKAWEDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECFARRAPYPNYDRDILTIDISRVTPNLMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIWRDPALCCYLSPGDEQVNCFNINYLRNVALVSGDTENAKGQGEQGSTGGTNISSTSEPKEE

Predict reactive species
Full Name extracellular matrix protein 1
Calculated Molecular Weight 540 aa, 61 kDa
Observed Molecular Weight60-80 kDa
GenBank Accession NumberBC023505
Gene Symbol ECM1
Gene ID (NCBI) 1893
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ16610
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ECM1 (extracellular matrix protein 1), also known as URBWD. It is located in secreted, extracellular space, and extracellular matrix, which is mainly expressed in esophagus and gall bladder. The gene encodes a soluble protein that is involved in endochondral bone formation, angiogenesis, and tumor biology. It also interacts with a variety of extracellular and structural proteins, contributing to the maintenance of skin integrity and homeostasis. Mutations in this gene are associated with lipoid proteinosis disorder (also known as hyalinosis cutis et mucosae or Urbach-Wiethe disease) that is characterized by generalized thickening of skin, mucosae and certain viscera. The calculated molecular weight of ECM1 is 60 kDa, and this antibody can recognize the 63 kDa isoform of target, moreover, this protein may have glycosylation modification.

Loading...
||
New chat Able
正在加载,请稍候...