Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CDKN2A/P16-INK4A Recombinant monoclonal antibody

CDKN2A/P16-INK4A Uni-rAb® Recombinant Antibody for WB, IHC, IHC-Autostainer, IF/ICC, ELISA

Cat No. 81373-8-RR
Clone No.241438C7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IHC-Autostainer, IF/ICC, ELISA

p16, p16 INK4, P16 INK4A, p16-INK4, p16INK4A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 555
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, TF-1 cells, SiHa cells
Positive IHC-Autostainer detected inhuman cervical cancer tissue
Positive IHC detected inhuman cervical cancer tissue, human tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)-AUTOSTAINERIHC-AUTOSTAINER : 1:250-1:1000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

81373-8-RR targets CDKN2A/P16-INK4A in WB, IHC, IHC-Autostainer, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1328

Product name: Recombinant human P16-INK4A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 52-156 aa of BC021998

Sequence: MMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD

Predict reactive species
Full Name cyclin-dependent kinase inhibitor 2A
Calculated Molecular Weight 16 kDa
Observed Molecular Weight 16 kDa
GenBank Accession NumberBC021998
Gene Symbol CDKN2A
Gene ID (NCBI) 1029
RRIDAB_3743382
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP42771
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CDKN2A generates several transcript variants which differ in their first exons. At least three alternatively-spliced variants encoding distinct proteins proteins were reported. Two of them named p16-INK4 and p14 are sharing 50% identity. P16 plays an essential role in regulating the cell cycle, and mutations in p16 increase the risk of developing various cancers, including melanoma. Long-term p16(INK4a) expression pushes cells to enter senescence, an irreversible cell-cycle arrest that precludes the growth of would-be cancer cells but also contributes to cellular aging (PMID: 24136988).

Protocols

Product Specific Protocols
IF protocol for CDKN2A/P16-INK4A antibody 81373-8-RRDownload protocol
IHC protocol for CDKN2A/P16-INK4A antibody 81373-8-RRDownload protocol
WB protocol for CDKN2A/P16-INK4A antibody 81373-8-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Biochem Pharmacol

Metformin reduces senescence induced by obesity-related inflammation in luminal breast cancer through estrogen receptor beta modulation.

Authors - Pere Miquel Morla-Barcelo

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Jordi (Verified Customer) (08-01-2025)

Antibody works very well in WB detection p16 band.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: Breast cancer cell lines (T47D and MCF7) and Colon cancer cell lines (SW480 and SW620)
Loading...
||
New chat

Able

正在加载,请稍候...