Tested Applications
| Positive WB detected in | HL-60 cells, human saliva |
| Positive IF/ICC detected in | HL-60 cells |
| Positive FC (Intra) detected in | HL-60 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:800-1:3200 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
81610-1-RR targets MPO in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag17564 Product name: Recombinant human MPO protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 606-657 aa of BC130476 Sequence: CGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRV Predict reactive species |
| Full Name | myeloperoxidase |
| Calculated Molecular Weight | 745 aa, 84 kDa |
| Observed Molecular Weight | 59 kDa, 90 kDa |
| GenBank Accession Number | BC130476 |
| Gene Symbol | MPO |
| Gene ID (NCBI) | 4353 |
| RRID | AB_2935565 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P05164 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The MPO gene encodes myeloperoxidase, a lysosomal hemoprotein located in the azurophilic granules of polymorphonuclear (PMN) leukocytes and monocytes. In response to stimulation, MPO is activated into a transient intermediate with potent antimicrobial oxidizing abilities(PMID:17650507). The mRNA is translated into a single protein of 90 kDa, which displays enzymatic activity and undergoes proteolytic maturation into a heavy chain of 59 kDa and a light chain of 13.5 kDa; these subunits then dimerize into the mature tetramer and the mature MPO is a heterotetramer composed of two identical heavy chains and two identical light chains(PMID:12773517). Fragments with molecular masses of 43-47 kDa were formed by autocatalysis during warming in sample buffer (PMID:12960244).The 24-kDa material had a map identical to that of 13.5 kDa subunit and represents a dimer of the 13.5 kDa subunit (PMID:3008892). Defects in MPO are the cause of myeloperoxidase deficiency (MPOD). It has 3 isoforms produced by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for MPO antibody 81610-1-RR | Download protocol |
| IF protocol for MPO antibody 81610-1-RR | Download protocol |
| WB protocol for MPO antibody 81610-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The MPO Recombinant monoclonal antibody (3J17), catalog number 81610-1-RR, has 3 total citations. These appear in Free Radical Biology and Medicine, Annals of Medicine, and Placenta. The research fields span diabetic wound healing and ferroptosis, acute respiratory distress syndrome (ARDS) via PI3K/AKT signaling, and placental inflammation in preeclampsia. Applications cited include IF and WB across human, mouse, and rat species.
| Species | Application | Title |
|---|---|---|
Free Radic Biol Med Neutrophil extracellular traps induce fibroblast ferroptosis via IRE1α/XBP1-mediated ER stress to impair diabetic wound healing | ||
Ann Med Chlorogenic acid mitigates acute respiratory distress syndrome via inhibition of the PI3K/AKT signalling pathway: an integrated analysis of bioinformatics and validation experiments. | ||
Placenta NETs exacerbate placental inflammation and injury through high mobility group protein B1 during preeclampsia |
