LAMA2 Recombinant monoclonal antibody, PBS Only (Detector)

LAMA2 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 83007-2-PBS
Clone No.230541D5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

230541D5, Laminin subunit alpha-2, Laminin-12 subunit alpha, Laminin-2 subunit alpha, Laminin-4 subunit alpha

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83007-2-PBS targets LAMA2 as part of a matched antibody pair:

MP00041-1: 83007-3-PBS capture and 83007-2-PBS detection (validated in Cytometric bead array)

MP00041-2: 83007-1-PBS capture and 83007-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34494

Product name: Recombinant human LAMA2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 2100-2250 aa of NM_000426

Sequence: IDKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIRTYKPEIKKGSYNNIVVNVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYPDLTIDDSYWYRIVASRTGRNGTISVRALDG

Predict reactive species
Full Name laminin, alpha 2
Calculated Molecular Weight344 kDa
Observed Molecular Weight344 kDa
GenBank Accession NumberNM_000426
Gene Symbol LAMA2
Gene ID (NCBI) 3908
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP24043
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The laminin subunit alpha 2 (LAMA2) gene encodes an alpha 2 chain, which constitutes one of the subunits of laminin 2 (merosin) and laminin 4 (s-merosin). Basal laminae are structural components of the extracellular matrix that influence cell proliferation and differentiation,7 and laminin subunit alpha 2 (LAMA2) is the major component of the basal laminae-α subunit of laminin. (PMID: 30728939)

Loading...
||
New chat Able
正在加载,请稍候...