• Featured Product
  • KD/KO Validated

HAS2 Recombinant monoclonal antibody, PBS Only (Capture)

HAS2 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 83204-2-PBS
Clone No.240061G4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Cytometric bead array, Indirect ELISA

240061G4, EC:2.4.1.212, HA synthase 2, hyaluronan synthase 2, Hyaluronate synthase 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83204-2-PBS targets HAS2 as part of a matched antibody pair:

MP00153-1: 83204-2-PBS capture and 83204-1-PBS detection (validated in Cytometric bead array)

MP00153-3: 83204-2-PBS capture and 83204-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34945

Product name: Recombinant human HAS2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 67-170 aa of BC069353

Sequence: EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSEDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETDESHKESSQH

Predict reactive species
Full Name hyaluronan synthase 2
Calculated Molecular Weight 552 aa, 64 kDa
Observed Molecular Weight 63-67 kDa
GenBank Accession NumberBC069353
Gene Symbol HAS2
Gene ID (NCBI) 3037
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ92819
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

RIT2 (Hyaluronan synthase 2) is a member of the gene family encoding the hyaluronan synthase 2, which can generate high-molecular-weight hyaluronan (HMW-HA) (PMID: 35069543). HAS2 is the most critical synthase in producing hyaluronan and is well known for its involvement in cancer growth, metabolism and metastasis (PMID: 36386154). HAS2 is involved in cellular acquired resistance to drug therapy in BrCa. HAS2 expression was decreased in the endocrine-resistant ER+BrCa cells.

Loading...
||
New chat Able
正在加载,请稍候...