GHITM Recombinant monoclonal antibody, PBS Only (Detector)

GHITM Uni-rAb® Recombinant Antibody for WB, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 83548-3-PBS
Clone No.240541D3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), Cytometric bead array, Indirect ELISA

240541D3, Dermal papilla-derived protein 2, DERP2, Growth hormone-inducible transmembrane protein, MICS1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83548-3-PBS targets GHITM as part of a matched antibody pair:

MP00524-1: 83548-2-PBS capture and 83548-3-PBS detection (validated in Cytometric bead array)

MP00524-2: 83548-1-PBS capture and 83548-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag35170

Product name: Recombinant human GHITM protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-72 aa of BC010354

Sequence: MLAARLVCLRTLPSRVFHPAFTKASPVVKNSITKNQWLLTPSREYATKTRIGIRRGRTGQELKEAALEPSME

Predict reactive species
Full Name growth hormone inducible transmembrane protein
Calculated Molecular Weight 345 aa, 37 kDa
Observed Molecular Weight37 kDa
GenBank Accession NumberBC010354
Gene Symbol GHITM
Gene ID (NCBI) 27069
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9H3K2
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GHITM, also known as MICS1, TMBIM5 or DERP2, is a mitochondrial protein that localizes in the inner membrane. GHITM is involved in mitochondrial morphology in specific cristae structures and the apoptotic release of cytochrome c from the mitochondria (PMID: 18417609). The gene of GHITM maps to chromosome 10q23.1, and encodes a 345-amino-acid protein with a calculated molecular mass of 37 kDa.

Loading...
||
New chat

Able

正在加载,请稍候...