GHITM Recombinant monoclonal antibody

• 

  WB analysis using 83548-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83548-3-RR (GHITM antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 83548-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83548-3-RR (GHITM antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  FC experiment of HeLa using 83548-3-RR

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug GHITM Recombinant antibody (83548-3-RR, Clone:240541D3) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 83548-3-RR

  Biolayer interferometry (BLl) kinetic assays of 83548-3-RR against Human GHITM were performed. The affinity constant is 2.41 nM.

GHITM Uni-rAb^® Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 83548-3-RR

Clone No.240541D3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), ELISA

Synonyms

240541D3, Dermal papilla-derived protein 2, DERP2, Growth hormone-inducible transmembrane protein, MICS1

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293T cells, SH-SY5Y cells, mouse liver tissue
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:600-1:4000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83548-3-RR targets GHITM in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35170

  Product name: Recombinant human GHITM protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-72 aa of BC010354

  Sequence: MLAARLVCLRTLPSRVFHPAFTKASPVVKNSITKNQWLLTPSREYATKTRIGIRRGRTGQELKEAALEPSME

• Full Name: growth hormone inducible transmembrane protein
• Calculated Molecular Weight: 345 aa, 37 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC010354
• Gene Symbol: GHITM
• Gene ID (NCBI): 27069
• RRID: AB_3671167
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H3K2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GHITM, also known as MICS1, TMBIM5 or DERP2, is a mitochondrial protein that localizes in the inner membrane. GHITM is involved in mitochondrial morphology in specific cristae structures and the apoptotic release of cytochrome c from the mitochondria (PMID: 18417609). The gene of GHITM maps to chromosome 10q23.1, and encodes a 345-amino-acid protein with a calculated molecular mass of 37 kDa.