Chemerin Recombinant monoclonal antibody

Chemerin Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 83550-4-RR
Clone No.240355A12

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, FC (Intra), ELISA

Rarres2, 240355A12, AI303516, Retinoic acid receptor responder protein 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse adipose tissue, mouse brown adipose tissue
Positive FC (Intra) detected inC57BL/6 mouse liver cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83550-4-RR targets Chemerin in WB, FC (Intra), ELISA applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0875

Product name: Recombinant mouse Chemerin protein

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 21-156 aa of NM_001347168.1

Sequence: EPELSETQRRSLQVALEEFHKHPPVQLAFQEIGVDRAEEVLFSAGTFVRLEFKLQQTNCPKKDWKKPECTIKPNGRRRKCLACIKMDPKGKILGRIVHCPILKQGPQDPQELQCIKIAQAGEDPHGYFLPGQFAFS

Predict reactive species
Full Name retinoic acid receptor responder (tazarotene induced) 2
Calculated Molecular Weight18 kDa
Observed Molecular Weight 14-19 kDa
GenBank Accession NumberNM_001347168.1
Gene Symbol Chemerin
Gene ID (NCBI) 71660
RRIDAB_3671168
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ9DD06
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Chemerin, also named as TIG2 and RARRES2, is adipocyte-secreted protein (adipokine) that regulates adipogenesis, metabolism and inflammation through activation of the chemokine-like receptor 1 (CMKLR1). Its other ligands include G protein-coupled receptor 1 (GPR1) and chemokine receptor-like 2 (CCRL2). It positively regulates adipocyte differentiation, modulates the expression of adipocyte genes involved in lipid and glucose metabolism and might play a role in angiogenesis, a process essential for the expansion of white adipose tissue. RARRES2 have both pro- and anti-inflammatory properties depending on the modality of enzymatic cleavage by different classes of proteases. The MW of Chemerin is 14-19 kDa.

Protocols

Product Specific Protocols
FC protocol for Chemerin antibody 83550-4-RRDownload protocol
WB protocol for Chemerin antibody 83550-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...