SLC30A2 Recombinant monoclonal antibody

SLC30A2 Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 83666-1-RR
Clone No.240405E3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

240405E3, PP12488, Proton-coupled zinc antiporter SLC30A2, ZnT 2, ZNT2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHaCaT cells, HeLa cells, NCCIT cells, MCF-7 cells, Caco-2 cells, HEK-293 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83666-1-RR targets SLC30A2 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag8232

Product name: Recombinant human SLC30A2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 234-323 aa of BC006251

Sequence: KGVDFTAVRDLLLSVEGVEALHSLHIWALTVAQPVLSVHIAIAQNTDAQAVLKTASSRLQGKFHFHTVTIQIEDYSEDMKDCQACQGPSD

Predict reactive species
Full Name solute carrier family 30 (zinc transporter), member 2
Calculated Molecular Weight 323 aa, 35 kDa
Observed Molecular Weight35 kDa and 52 kDa
GenBank Accession NumberBC006251
Gene Symbol SLC30A2
Gene ID (NCBI) 7780
RRIDAB_3671272
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ9BRI3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC30A2, also named as the Zn transporter 2 gene (ZnT2), belongs to the cation diffusion facilitator (CDF) transporter (TC 2.A.4) family and SLC30A subfamily. It plays a role in the zinc ion transmembrane transport. Expression of SLC30A2 is restricted to secretory cells, such as acinar pancreatic cells, prostate epithelial cells, placental trophoblasts, Paneth cells, and mammary epithelial cells (MECs). SLC30A2 consists of six transmembrane domains with cytoplasmic N- and C-termini that contain numerous regulatory domains, and function as a homo- or hetero-dimer to transport Zn into vesicles (PMID: 29476070 ). SLC30A2 has 2 isoforms with the molecular mass of 35 kDa (short isoform) and 41 kDa (long isoform). This antibody detects 2 bands of 35 kDa and 52 kDa ( glycosylation form of the long isoform) (PMID: 14608047, PMID: 28174721).

Protocols

Product Specific Protocols
FC protocol for SLC30A2 antibody 83666-1-RRDownload protocol
WB protocol for SLC30A2 antibody 83666-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...