Mouse Tissue Factor/CD142 Recombinant monoclonal antibody, PBS Only (Detector)

Tissue Factor/CD142 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 83887-4-PBS
Clone No.240875H3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA

CD142, Coagulation factor III, F3, Tissue factor, 240875H3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83887-4-PBS targets Tissue Factor/CD142 as part of a matched antibody pair:

MP00859-1: 83887-1-PBS capture and 83887-4-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1102

Product name: Recombinant Mouse Tissue Factor protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 29-251 aa of

Sequence: AGIPEKAFNLTWISTDFKTILEWQPKPTNYTYTVQISDRSRNWKNKCFSTTDTECDLTDEIVKDVTWAYEAKVLSVPRRNSVHGDGDQLVIHGEEPPFTNAPKFLPYRDTNLGQPVIQQFEQDGRKLNVVVKDSLTLVRKNGTFLTLRQVFGKDLGYIITYRKGSSTGKKTNITNTNEFSIDVEEGVSYCFFVQAMIFSRKTNQNSPGSSTVCTEQWKSFLGE

Predict reactive species
Full Name coagulation factor III
Calculated Molecular Weight33 kDa
Observed Molecular Weight48-53 kDa
Gene Symbol Tissue Factor
Gene ID (NCBI) 14066
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP20352
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Normal blood coagulation is a complex process, involving a cascade of activation of different plasma proteins, ultimately resulting in the formation of a clot, called fibrin. Tissue Factor (TF), also named Coagulation factor III or F3, is the primary initiator of the blood coagulation cascade and plays an essential role in hemostasis (PMID: 26877187; PMID: 33796108). This antibody is specific for mouse Tissue Factor.

Loading...
||
New chat

Able

正在加载,请稍候...