• Featured Product
  • KD/KO Validated

TOB1 Recombinant monoclonal antibody, PBS Only (Capture)

TOB1 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 83944-1-PBS
Clone No.241043A5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

241043A5, APRO6, PIG49, Protein Tob1, TOB

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83944-1-PBS targets TOB1 as part of a matched antibody pair:

MP00930-2: 83944-1-PBS capture and 83944-3-PBS detection (validated in Cytometric bead array)

MP00930-3: 83944-1-PBS capture and 83944-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6714

Product name: Recombinant human TOB1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-345 aa of BC031406

Sequence: MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVLYVDDNNENGCELDKEIKNSFNPEAQVFMPISDPASSVSSSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNKVARTSPINLGLNVNDLLKQKAISSSMHSLYGLGLGSQQQPQQQQQPAQPPPPPPPPQQQQQQKTSALSPNAKEFIFPNMQGQGSSTNGMFPGDSPLNLSPLQYSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQYSNQQFQPVMAN

Predict reactive species
Full Name transducer of ERBB2, 1
Calculated Molecular Weight 38 kDa
Observed Molecular Weight 38-45 kDa
GenBank Accession NumberBC031406
Gene Symbol TOB1
Gene ID (NCBI) 10140
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP50616
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TOB1, also known as APRO6 or TROB1, is a member of the transducer of erbB-2/B-cell translocation gene protein family. Members of this family are anti-proliferative factors that have the potential to regulate cell growth. The TOB1 protein has a large additional C-terminal region, which contains PAM2 motifs that mediate interactions with poly(A)-binding proteins. It is mainly located in the cell nucleus and will transfer between the cell nucleus and the cytoplasm. The more phosphorylation, the more obvious the cytoplasmic localization.The predicted MW of this protein is 38 kDa. Catalog#83944-1-RR recognises 38 and 45 kDa band, and the additional 45 kDa band may be due to phosphorylation.

Loading...
||
New chat

Able

正在加载,请稍候...