TOB1 Recombinant monoclonal antibody, PBS Only (Detector)

TOB1 Uni-rAb® Recombinant Antibody for IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 83944-2-PBS
Clone No.241043A9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, Cytometric bead array, Indirect ELISA

241043A9, APRO6, PIG49, Protein Tob1, TOB

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83944-2-PBS targets TOB1 as part of a matched antibody pair:

MP00930-3: 83944-1-PBS capture and 83944-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6714

Product name: Recombinant human TOB1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-345 aa of BC031406

Sequence: MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVLYVDDNNENGCELDKEIKNSFNPEAQVFMPISDPASSVSSSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNKVARTSPINLGLNVNDLLKQKAISSSMHSLYGLGLGSQQQPQQQQQPAQPPPPPPPPQQQQQQKTSALSPNAKEFIFPNMQGQGSSTNGMFPGDSPLNLSPLQYSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQYSNQQFQPVMAN

Predict reactive species
Full Name transducer of ERBB2, 1
Calculated Molecular Weight 38 kDa
GenBank Accession NumberBC031406
Gene Symbol TOB1
Gene ID (NCBI) 10140
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP50616
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TOB1, also known as APRO6 or TROB1, is a member of the transducer of erbB-2/B-cell translocation gene protein family. Members of this family are anti-proliferative factors that have the potential to regulate cell growth. The TOB1 protein has a large additional C-terminal region, which contains PAM2 motifs that mediate interactions with poly(A)-binding proteins. It is mainly located in the cell nucleus and will transfer between the cell nucleus and the cytoplasm. The more phosphorylation, the more obvious the cytoplasmic localization.

Loading...
||
New chat Able
正在加载,请稍候...