PPP2CA Recombinant monoclonal antibody, PBS Only (Capture)

PPP2CA Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 84155-2-PBS
Clone No.241112A6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, Cytometric bead array, Indirect ELISA

241112A6, EC:3.1.3.16, PP2A alpha, PP2A-alpha, PP2Ac

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84155-2-PBS targets PPP2CA as part of a matched antibody pair:

MP01058-2: 84155-2-PBS capture and 84155-4-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4294

Product name: Recombinant human PPP2CA protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-309 aa of BC031696

Sequence: MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL

Predict reactive species
Full Name protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform
Calculated Molecular Weight 309 aa, 36 kDa
Observed Molecular Weight 36 kDa
GenBank Accession NumberBC031696
Gene Symbol PPP2CA
Gene ID (NCBI) 5515
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP67775
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PPP2CA, also named as RP-C and PP2A-alpha, belongs to the PPP phosphatase family and PP-1 subfamily. PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase. PP2A activity was modestly decreased in AML patients harboring C-KIT/WT.PP2A is a target for C-KIT/TKD and implicated the potential efficacy of therapies targeting PP2A in such AML in future.

Loading...
||
New chat Able
正在加载,请稍候...