PDCD4 Recombinant monoclonal antibody

PDCD4 Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 84162-3-RR
Clone No.241463E3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

241463E3, Dug, H731, Nuclear antigen H731-like, PDCD 4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inBxPC-3 cells, HeLa cells, HUVEC cells, MCF-7 cells, HEK-293 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84162-3-RR targets PDCD4 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3288

Product name: Recombinant human PDCD4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 169-469 aa of BC026104

Sequence: TPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIIMVLESTGESTFKMILDLLKSLWKSSTITVDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPSRGRKRFVSEGDGGRLKPESY

Predict reactive species
Full Name programmed cell death 4 (neoplastic transformation inhibitor)
Calculated Molecular Weight 469 aa, 52 kDa
Observed Molecular Weight 54-64 kDa
GenBank Accession NumberBC026104
Gene Symbol PDCD4
Gene ID (NCBI) 27250
RRIDAB_3671724
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ53EL6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Programmed cell death 4 (Pdcd4) is a novel tumor suppressor that inhibits translation, progression and invasion. It was first identified as being differnetially upregulated during apoptosis. Pdcd4 interferes with the activity of the eukaryotic initiation factor (eIF) 4A by displacing the scaffold protein eIF4G from its binding to the RNA helicase eIF4A. The calculated molecular wight of unmodified PDCD4 protein is 52 kDa, but the modified protein is about 54-64 kDa.

Protocols

Product Specific Protocols
FC protocol for PDCD4 antibody 84162-3-RRDownload protocol
WB protocol for PDCD4 antibody 84162-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...