Use Able AI chat for product recommendations

NeuN Recombinant monoclonal antibody

NeuN antibodies are widely used as neuronal markers to identify and quantify mature neurons in brain and spinal cord tissue in neuroscience research. Proteintech has an extensive range of NeuN antibodies validated for WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA and Dot blot.

Cat No. 84401-4-RR
Clone No.241461G7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, IF-Fro, ELISA

241461G7, Fox-1 homolog C, FOX3, HRNBP3, NeuN antigen

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse cerebellum tissue, mouse brain tissue, pig brain tissue, rat cerebellum tissue, rat brain tissue
Positive IHC detected inrat cerebellum tissue, mouse cerebellum tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inrat brain tissue
Positive IF-Fro detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:3000-1:12000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)-FROIF-FRO : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84401-4-RR targets NeuN in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivitymouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25689

Product name: Recombinant human NeuN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-100 aa of NM_001082575

Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR

Predict reactive species
Full Name hexaribonucleotide binding protein 3
Observed Molecular Weight 46-52 kDa
GenBank Accession NumberNM_001082575
Gene Symbol NeuN
Gene ID (NCBI) 146713
RRIDAB_3671930
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDA6NFN3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NeuN, encoded by FOX3, is a neuron-specific nuclear protein. Anti-NeuN stains exclusively neuronal cells in the central and peripheral nervous systems, especially postmitotic and differentiating neurons, as well as terminally differentiated neurons. Anti-NeuN has been used widely as a reliable tool to detect most postmitotic neuronal cell types. The immunohistochemical staining is primarily localized in the nucleus of the neurons with lighter staining in the cytoplasm.

Protocols

Product Specific Protocols
IF protocol for NeuN antibody 84401-4-RRDownload protocol
IHC protocol for NeuN antibody 84401-4-RRDownload protocol
WB protocol for NeuN antibody 84401-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
ratIF

J Integr Neurosci

A Novel Long-Term Intrathecal Cannulation Technique in Rats: L5-L6 Approach With Cervical Externalization for Chronic Drug Delivery.

Authors - Wen-Ming Zhou
ratWB

Mol Pain

Electroacupuncture at Zusanli (ST36) alleviates paclitaxel-induced neuropathic pain in rats via regulating TLR4 signaling pathway in the spinal cord.

Authors - Man-Ni Wang
mouseIF

Br J Pharmacol

Protective effect of scorpion-venom heat-resistant peptide (SVHRSP) against depression associated with Parkinson's disease via suppression of CREB-Akt pathway-mediated inflammation.

Authors - Muhammad Khalid Iqbal

Reviews

    5.0 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Noelia (Verified Customer) (08-27-2026)

It works so good

  • Applications: Immunofluorescence
  • Cell Tissue Type: Brain

Philip (Verified Customer) (12-18-2025)

50 micron cryosections of 4% paraformaldehyde fixed mouse brain. Tested downn to 1:5000 dilution and all concentrations worked very well.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: Mouse brain
Loading...
||
New chat

Able

正在加载,请稍候...