Tested Applications
| Positive WB detected in | THP-1 cells, HepG2 cells, RAW 264.7 cells, HuH-7 cells, SMMC-7721 cells |
| Positive IHC detected in | human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:1250-1:5000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
84413-3-RR targets CCL20/MIP-3 alpha in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg2398 Product name: Recombinant Human CCL20/MIP-3 alpha protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 27-96 aa of NM_004591.3 Sequence: ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM Predict reactive species |
| Full Name | chemokine (C-C motif) ligand 20 |
| Calculated Molecular Weight | 11kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | NM_004591.3 |
| Gene Symbol | CCL20/MIP-3 alpha |
| Gene ID (NCBI) | 6364 |
| RRID | AB_3671942 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P78556-1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CCL20, also known as macrophage infiltrating factor protein 3α, is a C-C chemokine that specifically binds to the receptor CCR6. CCL20 is produced in various tissues and by a wide range of immune cells, including neutrophils, natural killer cells, T-helper type 17 (Th17) cells, B cells, and various antigen-presenting cells, such as dendritic cells (DCs), Langerhans cells, and macrophages. Increased expression of CCL20 is likely involved in the increased recruitment of dendritic cells observed in fibroinflammatory diseases such as chronic obstructive pulmonary disease (COPD). CCL20 expression is increased by the proinflammatory cytokine IL-1 beta.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CCL20/MIP-3 alpha antibody 84413-3-RR | Download protocol |
| WB protocol for CCL20/MIP-3 alpha antibody 84413-3-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
