CoraLite® Plus 488-conjugated TRAF2 Recombinant monoclonal antibody

TRAF2 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-84581-3
Clone No.241899A2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

241899A2, E3 ubiquitin-protein ligase TRAF2, EC:2.3.2.27, RING-type E3 ubiquitin transferase TRAF2, TNF receptor-associated factor 2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84581-3 targets TRAF2 in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25387

Product name: Recombinant human TRAF2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 438-501 aa of BC032410

Sequence: NNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL

Predict reactive species
Full Name TNF receptor-associated factor 2
Calculated Molecular Weight 56 kDa
Observed Molecular Weight53 kDa
GenBank Accession NumberBC032410
Gene Symbol TRAF2
Gene ID (NCBI) 7186
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ12933
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Tumor necrosis factor (TNF) receptor-associated factor-2 (TRAF2) is one of the members of the TRAF superfamily protein, which is an intracellular junction protein with E3 ligase activity. TRAF2 mediates and regulates the activation of nuclear factor kappa B (NF-κB) and microtubule-associated protein kinase (MAPK) signaling pathways by binding to TNFR family proteins. Recent studies have demonstrated that TRAF2 regulates tumor progression by through multiple pathways.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 TRAF2 antibody CL488-84581-3Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...