Tested Applications
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-84581-3 targets TRAF2 in IF/ICC applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25387 Product name: Recombinant human TRAF2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 438-501 aa of BC032410 Sequence: NNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL Predict reactive species |
| Full Name | TNF receptor-associated factor 2 |
| Calculated Molecular Weight | 56 kDa |
| Observed Molecular Weight | 53 kDa |
| GenBank Accession Number | BC032410 |
| Gene Symbol | TRAF2 |
| Gene ID (NCBI) | 7186 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q12933 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Tumor necrosis factor (TNF) receptor-associated factor-2 (TRAF2) is one of the members of the TRAF superfamily protein, which is an intracellular junction protein with E3 ligase activity. TRAF2 mediates and regulates the activation of nuclear factor kappa B (NF-κB) and microtubule-associated protein kinase (MAPK) signaling pathways by binding to TNFR family proteins. Recent studies have demonstrated that TRAF2 regulates tumor progression by through multiple pathways.
