• All
  • Primary Antibodies
  • Conjugated Antibodies for IF
  • Conjugated Antibodies for FC
  • Secondary Antibodies
  • Antibody Labeling KitsNew
  • ELISA Kits
  • IHC Kits
  • Magnetic Cell Separation Kits
  • Cytokines & Growth Factors
  • Neutralizing/activating Antibodies
  • Nanobody-based Reagents
  • Accessory Products and Kits
  • Fusion Proteins
×
×
Host
0
Species Reactivity
0
Species Reactivity
0
Conjugate
0
Conjugate
0
Compatible Species
0
Conjugate
0
Filter:
  • Western Blot (WB) analysis of various lysates using NNMT Recombinant antibody (84876-5-RR)

    WB analysis using 84876-5-RR

    Various lysates were subjected to SDS PAGE followed by western blot with 84876-5-RR (NNMT antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  • Immunoprecipitation (IP) experiment of L02 cells using NNMT Recombinant antibody (84876-5-RR)

    IP experiment of L02 using 84876-5-RR

    IP result of anti-NNMT (IP:84876-5-RR, 4ug; Detection:84876-5-RR 1:1500) with L02 cells lysate 1120 ug.

  • Flow cytometry (FC) experiment of HepG2 cells using NNMT Recombinant antibody (84876-5-RR)

    FC experiment of HepG2 using 84876-5-RR

    1x10^6 HepG2 cells were intracellularly stained with 0.25 ug NNMT Recombinant antibody (84876-5-RR, Clone:242394B7) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  • Affinity and Kinetic Characterization of 84876-5-RR

    Affinity and Kinetic Characterization of 84876-5-RR

    Biolayer interferometry (BLl) kinetic assays of 84876-5-RR against Human NNMT were performed. The affinity constant is 0.824 nM.

NNMT Recombinant monoclonal antibody

NNMT Uni-rAb® Recombinant Antibody for WB, FC (Intra), IP, ELISA
Cat No. 84876-5-RR
Clone No.242394B7

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, FC (Intra), IP, ELISA

Synonyms

242394B7, EC:2.1.1.1, Nicotinamide N-methyltransferase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Please visit your regions distributor:

Tested Applications

Positive WB detected inL02 cells, SGC-7901 cells, rat liver tissue
Positive IP detected inL02 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84876-5-RR targets NNMT in WB, FC (Intra), IP, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7197

Product name: Recombinant human NNMT protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-264 aa of BC000234

Sequence: MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL

Predict reactive species
Full Name nicotinamide N-methyltransferase
Calculated Molecular Weight 30 kDa
Observed Molecular Weight 30 kDa
GenBank Accession NumberBC000234
Gene Symbol NNMT
Gene ID (NCBI) 4837
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP40261
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NNMT can catalyze the N-methylation of nicotinamide using the universal methyl donor S-adenosyl-L-methionine to form N1-methylnicotinamide and S-adenosyl-L-homocysteine, a predominant nicotinamide/vitamin B3 clearance pathway (PMID: 21823666; 23455543; 8182091). It plays a central role in regulating cellular methylation potential, by consuming S-adenosyl-L-methionine and limiting its availability for other methyltransferases. Actively mediates genome-wide epigenetic and transcriptional changes through hypomethylation of repressive chromatin marks, such as H3K27me3 (PMID: 23455543; PMID: 26571212; PMID: 31043742).

Protocols

Product Specific Protocols
FC protocol for NNMT antibody 84876-5-RRDownload protocol
IP protocol for NNMT antibody 84876-5-RRDownload protocol
WB protocol for NNMT antibody 84876-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
||
New chat Able
正在加载，请稍候...