NNMT Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84876-5-RR (same clone as 84876-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84876-5-RR (NNMT antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84876-5-PBS in a different storage buffer formulation.

• 

  IP experiment of L02 using 84876-5-RR (same clone as 84876-5-PBS)

  IP result of anti-NNMT (IP:84876-5-RR, 4ug; Detection:84876-5-RR 1:1500) with L02 cells lysate 1120 ug. This data was developed using the same antibody clone with 84876-5-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 84876-5-RR (same clone as 84876-5-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug NNMT Recombinant antibody (84876-5-RR, Clone:242394B7) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 84876-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84876-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84876-5-RR against Human NNMT were performed. The affinity constant is 0.824 nM.

NNMT Uni-rAb^® Recombinant Antibody for WB, FC (Intra), IP, Indirect ELISA

Cat No. 84876-5-PBS

Clone No.242394B7

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, FC (Intra), IP, Indirect ELISA

Synonyms

242394B7, EC:2.1.1.1, Nicotinamide N-methyltransferase

---

Product Information

84876-5-PBS targets NNMT in WB, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7197

  Product name: Recombinant human NNMT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-264 aa of BC000234

  Sequence: MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL

• Full Name: nicotinamide N-methyltransferase
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC000234
• Gene Symbol: NNMT
• Gene ID (NCBI): 4837
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P40261
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NNMT can catalyze the N-methylation of nicotinamide using the universal methyl donor S-adenosyl-L-methionine to form N1-methylnicotinamide and S-adenosyl-L-homocysteine, a predominant nicotinamide/vitamin B3 clearance pathway (PMID: 21823666; 23455543; 8182091). It plays a central role in regulating cellular methylation potential, by consuming S-adenosyl-L-methionine and limiting its availability for other methyltransferases. Actively mediates genome-wide epigenetic and transcriptional changes through hypomethylation of repressive chromatin marks, such as H3K27me3 (PMID: 23455543; PMID: 26571212; PMID: 31043742).