YBX1 Recombinant monoclonal antibody

YBX1 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 84993-4-RR
Clone No.242462F12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

242462F12, CBF A, CBF-A, CCAAT-binding transcription factor I subunit A, DBPB

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMCF-7 cells, Jurkat cells, MDA-MB-231 cells, HEK-293 cells, HeLa cells, NIH/3T3 cells
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells, Neuro-2a cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84993-4-RR targets YBX1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag14129

Product name: Recombinant human YBX1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 134-303 aa of BC010430

Sequence: QGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKET

Predict reactive species
Full Name Y box binding protein 1
Calculated Molecular Weight 324 aa, 36 kDa
Observed Molecular Weight 36-56 kDa
GenBank Accession NumberBC010430
Gene Symbol YBX1
Gene ID (NCBI) 4904
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP67809
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Y box binding protein 1(YBX1) is one of cis-acting elements which has a role in regulation of the expression of HLA class II genes. YBX1 is great of importance in regulation of PTP1B expression. It can bind to splice sites mediate pre-mRNA alternative splicing regulation. Also, it involves the regulation of translation by modulation of the interaction between the mRNA and eukaryotic initiation factors. Its transcriptional activity on the multidrug resistance gene MDR1 is enhanced in presence of the APEX1 acetylated form at 'Lys-6' and 'Lys-7'. The secreted form acts as an extracellular mitogen and stimulates cell migration and proliferation. The calculated molecular weight of YBX1 is 36 kDa, but modified YBX1 is about 36-56 kDa. (PMID: 27384875 )

Protocols

Product Specific Protocols
IF protocol for YBX1 antibody 84993-4-RRDownload protocol
IHC protocol for YBX1 antibody 84993-4-RRDownload protocol
WB protocol for YBX1 antibody 84993-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...