YBX1 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• YBX1 Recombinant monoclonal antibody, PBS Only (84993-4-PBS)

YBX1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 84993-4-PBS Copied!

Clone No. 242462F12

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

242462F12, CBF A, CBF-A, CCAAT-binding transcription factor I subunit A, DBPB

• 

  WB analysis using 84993-4-RR (same clone as 84993-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84993-4-RR (YBX1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84993-4-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 84993-4-RR (same clone as 84993-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 84993-4-RR (YBX1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84993-4-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 84993-4-RR (same clone as 84993-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 84993-4-RR (YBX1 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84993-4-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 84993-4-RR (same clone as 84993-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using YBX1 antibody (84993-4-RR, Clone: 242462F12 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84993-4-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of Neuro-2a using 84993-4-RR (same clone as 84993-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Neuro-2a cells using YBX1 antibody (84993-4-RR, Clone: 242462F12 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84993-4-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 84993-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84993-4-RR against Human YBX1 were performed. The affinity constant is below 1 pM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for YBX1 in ?

Chat with Able

---

Product Information

84993-4-PBS targets YBX1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14129

  Product name: Recombinant human YBX1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 134-303 aa of BC010430

  Sequence: QGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKET

• Full Name: Y box binding protein 1
• Calculated Molecular Weight: 324 aa, 36 kDa
• Observed Molecular Weight: 36-56 kDa
• GenBank Accession Number: BC010430
• Gene Symbol: YBX1
• Gene ID (NCBI): 4904
• RRID: AB_3743919
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P67809
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Y box binding protein 1(YBX1) is one of cis-acting elements which has a role in regulation of the expression of HLA class II genes. YBX1 is great of importance in regulation of PTP1B expression. It can bind to splice sites mediate pre-mRNA alternative splicing regulation. Also, it involves the regulation of translation by modulation of the interaction between the mRNA and eukaryotic initiation factors. Its transcriptional activity on the multidrug resistance gene MDR1 is enhanced in presence of the APEX1 acetylated form at 'Lys-6' and 'Lys-7'. The secreted form acts as an extracellular mitogen and stimulates cell migration and proliferation. The calculated molecular weight of YBX1 is 36 kDa, but modified YBX1 is about 36-56 kDa. (PMID: 27384875 )

Publications

What published studies show

The antibody ALYREF (Cat# 84993-4-PBS) has a total of 1 citation. It appears in the journal Tissue Cell (Impact Factor 3.1), published in 2026. The associated research field is gastric cancer, specifically investigating how ALYREF expression correlates with upregulated YBX1 and HIF1α to contribute to cell migration. The application used was Western Blot (WB) in human samples with RNAi validation.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Tissue Cell; ALYREF expression correlated with upregulated YBX1 and HIF1α, contributing to cell migration in gastric cancer.; Authors - Yujie Yuan ; KD Validated