DOCK11 Recombinant monoclonal antibody, PBS Only (Capture)

DOCK11 Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 85022-3-PBS
Clone No.242575H5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

242575H5, ACG, bB128O4.1, dedicator of cytokinesis 11, ZIZ2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85022-3-PBS targets DOCK11 as part of a matched antibody pair:

MP01759-2: 85022-3-PBS capture and 85022-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag35831

Product name: Recombinant human DOCK11 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 250-400 aa of NM_144658

Sequence: HYLAAETEQEMEEWLITLKKIIQINTDSLVQEKKETVETAQDDETSSQGKAENIMASLERSMHPELMKYGRETEQLNKLSRGDGRQNLFSFDSEVQRLDFSGIEPDIKPFEEKCNKRFLVNCHDLTFNILGQIGDNAKGPPTNVEPFFINL

Predict reactive species
Full Name dedicator of cytokinesis 11
Calculated Molecular Weight238 kDa
Observed Molecular Weight238 kDa
GenBank Accession NumberNM_144658
Gene Symbol DOCK11
Gene ID (NCBI) 139818
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ5JSL3
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

DOCK11(also known as Zizimin2) is a member of CDM (Ced-5, DOCK180, and Myoblast City) family guanine nucleotide exchange factor mainly expressed in immune cells. As a guanine nucleotide exchange factor, DOCK11 activated the rho family GTPase cell division cycle 42 (CDC42), resulting in cytoskeletal reorganization.

Loading...
||
New chat

Able

正在加载,请稍候...