NME1/2 Recombinant monoclonal antibody

NME1/2 Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 85074-2-RR
Clone No.242698C7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), ELISA

NME2, 242698C7, C-myc purine-binding transcription factor PUF, EC:2.7.13.3, EC:2.7.4.6

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse kidney tissue, mouse liver tissue
Positive FC (Intra) detected inHEK-293T cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85074-2-RR targets NME1/2 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag13913

Product name: Recombinant human NME2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-152 aa of BC002476

Sequence: MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE

Predict reactive species
Full Name non-metastatic cells 2, protein (NM23B) expressed in
Calculated Molecular Weight 152 aa, 17 kDa
Observed Molecular Weight 17 kDa
GenBank Accession NumberBC002476
Gene Symbol NME2
Gene ID (NCBI) 4831
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP22392
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NME2(non-metastatic cells 2, protein) is also named as NDKB(Nucleoside diphosphate kinase B), NM23B and belongs to the NDK family. It is involved in the phosphorylation of nucleoside diphosphates and interacts with membrane receptor and constituting a novel molecular regulatory mechanism of GPCR endocytosis. This protein has 2 isoforms produced by alternative splicing. Refer to epitope and protein detection, the antibody 85074-2-RR detects both NME1& NME2.

Protocols

Product Specific Protocols
FC protocol for NME1/2 antibody 85074-2-RRDownload protocol
WB protocol for NME1/2 antibody 85074-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...