SELL Recombinant monoclonal antibody, PBS Only (Capture)

SELL Uni-rAb® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 85111-3-PBS
Clone No.242283F9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

CD62L, L-selectin, CD62 antigen-like family member L, gp90 MEL, gp90-MEL

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85111-3-PBS targets SELL as part of a matched antibody pair:

MP01864-3: 85111-3-PBS capture and 85111-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3006

Product name: Recombinant Human CD62L protein (rFc Tag)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 39-332 aa of NM_000655.5

Sequence: WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYN

Predict reactive species
Full Name selectin L
Calculated Molecular Weight42 kDa
GenBank Accession NumberNM_000655.5
Gene Symbol CD62L
Gene ID (NCBI) 6402
ENSEMBL Gene IDENSG00000188404
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP14151-1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...