INPP4B Recombinant monoclonal antibody, PBS Only (Detector)

INPP4B Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 85151-4-PBS
Clone No.242837H2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

242837H2, EC:3.1.3.66, Inositol polyphosphate 4-phosphatase type II, Type II inositol 3,4-bisphosphate 4-phosphatase

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85151-4-PBS targets INPP4B as part of a matched antibody pair:

MP01878-1: 85151-3-PBS capture and 85151-4-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag8676

Product name: Recombinant human INPP4B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-53 aa of BC005273

Sequence: MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILDLNQELRD

Predict reactive species
Full Name inositol polyphosphate-4-phosphatase, type II, 105kDa
Calculated Molecular Weight 53 aa, 6 kDa
Observed Molecular Weight 100-110 kDa
GenBank Accession NumberBC005273
Gene Symbol INPP4B
Gene ID (NCBI) 8821
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO15327
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

INPP4B (Inositol polyphosphate 4-phosphatase type II) can catalyze the hydrolysis of the 4-position phosphate of phosphatidylinositol 3,4-bisphosphate, inositol 1,3,4-trisphosphate and inositol 3,4-trisphosphate (PMID: 24070612; 24591580). It also Plays a role in the late stages of macropinocytosis by dephosphorylating phosphatidylinositol 3,4-bisphosphate in membrane ruffles (PMID: 24591580).

Loading...
||
New chat Able
正在加载,请稍候...