TOMM40 Recombinant monoclonal antibody

TOMM40 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 85773-4-RR
Clone No.250010E12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

TOM40, C19orf1, D19S1177E, p38.5, PER EC1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, NIH/3T3 cells, HSC-T6 cells
Positive IHC detected inmouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85773-4-RR targets TOMM40 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag13065

Product name: Recombinant human TOMM40 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-361 aa of BC017224

Sequence: MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG

Predict reactive species
Full Name translocase of outer mitochondrial membrane 40 homolog (yeast)
Calculated Molecular Weight 38 kDa
Observed Molecular Weight38 kDa
GenBank Accession NumberBC017224
Gene Symbol TOMM40
Gene ID (NCBI) 10452
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO96008
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The translocase of outer mitochondria membrane 40 (TOMM40, also known as TOM40), located in the center of the TOM complex, is a channel-forming subunit of translocase. It can facilitate the fluid movement of preproteins into the mitochondria by associating with TOMM20. TOMM40 plays a role in the assembly of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) by forming a complex with BCAP31 and mediating the translocation of Complex I components from the cytosol to the mitochondria (PMID: 31206022). TOMM40 has been reported to be associated with late-onset neurodegenerative diseases such as Alzheimer's disease and Parkinson's disease.

Protocols

Product Specific Protocols
IF protocol for TOMM40 antibody 85773-4-RRDownload protocol
WB protocol for TOMM40 antibody 85773-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...