TOMM40 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85773-4-RR (same clone as 85773-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85773-4-RR (TOMM40 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85773-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 85773-4-RR (same clone as 85773-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 85773-4-RR (TOMM40 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85773-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 85773-4-RR (same clone as 85773-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 85773-4-RR (TOMM40 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85773-4-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 85773-4-RR (same clone as 85773-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using TOMM40 antibody (85773-4-RR, Clone: 250010E12 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 85773-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85773-4-RR

  Biolayer interferometry (BLl) kinetic assays of 85773-4-RR against Human TOMM40 were performed. The affinity constant is 1.59 nM.

TOMM40 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 85773-4-PBS

Clone No.250010E12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

TOM40, C19orf1, D19S1177E, p38.5, PER EC1

---

Product Information

85773-4-PBS targets TOMM40 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13065

  Product name: Recombinant human TOMM40 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-361 aa of BC017224

  Sequence: MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG

• Full Name: translocase of outer mitochondrial membrane 40 homolog (yeast)
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC017224
• Gene Symbol: TOMM40
• Gene ID (NCBI): 10452
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O96008
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The translocase of outer mitochondria membrane 40 (TOMM40, also known as TOM40), located in the center of the TOM complex, is a channel-forming subunit of translocase. It can facilitate the fluid movement of preproteins into the mitochondria by associating with TOMM20. TOMM40 plays a role in the assembly of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) by forming a complex with BCAP31 and mediating the translocation of Complex I components from the cytosol to the mitochondria (PMID: 31206022). TOMM40 has been reported to be associated with late-onset neurodegenerative diseases such as Alzheimer's disease and Parkinson's disease.